SecReT6
Protein ID: 387906489
SecReT6 ID661
T6SS typei2
Gene symbol-
Locus tagMYA_5758
StrainBurkholderia sp. KJ006
Repliconchromosome III [GenBank: NC_017922] [Browse all T6SS(s) in this replicon]
Location [Strand]785244..786341 [-]
ProductType VI secretion protein, VC_A0111 family
NoteTssG
UniProt IDI2DZL9
KEGG IDbuk:MYA_5758
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.10E-83, Aligned region: 19..332
Protein Sequence: 365 a.a.     [Download]
>gi|387906489|ref|YP_006336826.1| Type VI secretion protein, VC_A0111 family [Burkholderia sp. KJ006]
MKPQNLPNLDPLVASLMARAPLMNFMQLCRLLELRVPGRPGFGTRDALAHESVRFRPRPRTGFPAGEVAS
VDFDDERPDAPPTVRTTFMGLYGVDAAMPSHMIDDIVLREEGHEVVEAFLDQFNHRFVTLLYRAWKKYRY
PESFRDGGADAHSRSLLCLAGFGWGDKPQRAGLPDSRMLALLGLLIQRTRTPEGLAGVVALAVPGVGVRV
DEFFPVLTRAGRPRPLTSAGHAPVSDGAARRGLGGGYVLGRRLAYRCRAVLVTVQPADARQAQDLLPGAR
LHRELMAVVRLYVGVKADVHLRMEISSRHAPRPAIGSALTDPSPRLGWTTVLPGDEERFISIALGVCEAF
PAPRPNPRLTASHAA
 
Nucleotide Sequence: 1098 bp     [Download]
>gi|387905813|ref|NC_017922.1|:c786341-785244 Burkholderia sp. KJ006 chromosome 3, complete sequence
ATGAAGCCGCAGAACTTGCCGAATCTCGACCCGCTGGTCGCGTCGTTGATGGCACGCGCACCGCTGATGA
ACTTCATGCAGCTTTGCCGGCTGCTCGAACTGCGTGTTCCCGGGCGGCCGGGGTTCGGTACACGCGATGC
GCTGGCGCACGAATCCGTGCGCTTCCGGCCGCGACCGCGTACGGGTTTTCCGGCGGGCGAGGTCGCGTCG
GTCGACTTCGATGACGAACGGCCCGATGCGCCGCCGACCGTGCGTACGACTTTCATGGGGCTATACGGCG
TCGATGCGGCGATGCCGTCGCACATGATTGACGACATCGTGCTGCGCGAGGAAGGGCACGAAGTGGTCGA
AGCGTTTCTCGACCAGTTCAATCACCGCTTCGTCACGCTGCTGTACCGTGCGTGGAAGAAGTACCGTTAT
CCGGAGAGTTTCCGCGACGGCGGAGCCGACGCGCATTCGCGCAGTCTGCTGTGCCTGGCCGGCTTCGGCT
GGGGCGACAAGCCGCAGCGCGCAGGACTGCCCGATTCGCGGATGCTCGCGCTGCTGGGCTTGTTGATTCA
GCGAACGCGAACGCCCGAAGGTCTCGCAGGCGTCGTTGCGCTCGCGGTGCCCGGCGTCGGTGTGCGGGTC
GACGAGTTCTTTCCGGTGCTCACGCGGGCTGGACGGCCGCGGCCACTGACTTCCGCGGGCCATGCCCCGG
TGTCCGACGGCGCTGCTCGCCGGGGGCTCGGGGGCGGCTACGTGCTCGGCCGCAGGCTTGCCTATCGCTG
TCGCGCGGTGCTCGTCACGGTGCAGCCGGCCGACGCGCGACAGGCCCAGGATCTGCTGCCCGGTGCTCGG
CTGCATCGGGAGCTGATGGCGGTGGTGCGGTTGTATGTGGGCGTAAAGGCGGACGTTCATCTGCGTATGG
AGATTTCTTCGCGACATGCGCCCAGGCCGGCGATCGGGTCAGCCTTAACGGATCCGTCGCCGCGCCTCGG
CTGGACGACCGTTCTGCCGGGCGATGAAGAGCGCTTTATCAGCATCGCACTCGGCGTCTGCGAAGCGTTT
CCCGCGCCCAGGCCAAATCCGCGCCTCACCGCGTCGCATGCTGCGTAA
 Primer design