SecReT6
Protein ID: 387906490
SecReT6 ID661
T6SS typei2
Gene symbol-
Locus tagMYA_5759
StrainBurkholderia sp. KJ006
Repliconchromosome III [GenBank: NC_017922] [Browse all T6SS(s) in this replicon]
Location [Strand]786338..788152 [-]
ProductType VI secretion protein, VC_A0110 family
NoteTssF
UniProt IDI2DZM0
KEGG IDbuk:MYA_5759
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.30E-182, Aligned region: 8..603
Protein Sequence: 604 a.a.     [Download]
>gi|387906490|ref|YP_006336827.1| Type VI secretion protein, VC_A0110 family [Burkholderia sp. KJ006]
MENDDPILRYYEAEMRYLRESGKEFAKAHPDRARLLNLDRVGDRDPYVERLFEGFAFLTGRLRQKLDDEL
PELTEGLVSLLWPHYLRMIPSLSIVELVPLAEKLQKTEVVPAGVPVRSAPIAVPAAAGGEGAMPKTVQCV
YRTTQPVTLQPVAIAHASPSVRHDGRSVIRLGFTLDESARRTETDLSQLRLHLSADLPTAFAMHVALTRH
VDAIHWRVPEIRDGEAVPLDGVTIKPAGFSSEERLWPKADAAFSGYQLLLEYFTFREKFLFVDLCGLDVT
KLPERSTQFELEIVLKHAYPSDQRFSAENVRLFCSPVINLFELDAEPIEIDHHQTEYRVVPAGHQGEHVE
TYSVDAIDAFDHETAERYEYVPFATFRHRGGMLRHEAPERYFHTRVRPGVSGLHETWVILGGHAWETMDA
LPEESLSLRVTGTNGLLPRKGLREASLNELATSTQNVAGVRNLVSPTLPLYPPTEDRFQWRVLSHLAPNF
LSMMNAEVLRGALALYDWTNDELNRRRLAGILWVSQELIEEVSGGAVERGVSIEVTLDSHAFAGDGDVML
FGELLHRFFALYADINLFTKLAIVSLPAQARTEWPRSKAERAPL
 
Nucleotide Sequence: 1815 bp     [Download]
>gi|387905813|ref|NC_017922.1|:c788152-786338 Burkholderia sp. KJ006 chromosome 3, complete sequence
ATGGAAAACGACGATCCGATCCTGCGCTACTACGAAGCGGAAATGCGCTACCTGCGGGAGTCCGGCAAGG
AGTTCGCGAAGGCGCATCCCGACCGCGCGCGACTGCTCAACCTTGATCGCGTAGGCGATCGCGATCCCTA
CGTCGAGCGATTGTTCGAAGGCTTCGCGTTCCTGACCGGCCGACTGCGACAGAAGCTCGACGACGAACTG
CCGGAACTGACCGAAGGACTGGTGAGCCTGCTATGGCCGCACTATCTGCGGATGATTCCGTCGCTGTCGA
TTGTGGAGCTCGTGCCGCTCGCGGAAAAATTGCAGAAGACCGAAGTCGTGCCGGCGGGCGTGCCCGTGCG
CTCCGCGCCGATCGCGGTACCGGCTGCGGCTGGTGGGGAAGGCGCGATGCCGAAGACCGTGCAATGCGTG
TACCGAACCACACAGCCCGTGACGCTGCAGCCGGTCGCGATCGCGCACGCGAGTCCAAGCGTACGTCACG
ACGGGCGCTCGGTGATCCGGCTCGGCTTCACGCTCGACGAGTCGGCACGCCGCACGGAAACCGATTTGTC
GCAACTGCGCTTGCACCTGAGCGCGGACCTGCCGACTGCGTTCGCGATGCACGTCGCGCTCACGCGCCAC
GTCGATGCGATCCATTGGCGGGTACCGGAGATTCGCGACGGCGAAGCCGTGCCGCTCGATGGCGTGACGA
TCAAGCCGGCCGGGTTTTCGAGTGAGGAGCGGCTGTGGCCGAAGGCCGATGCTGCGTTTTCCGGGTATCA
GCTGCTGCTCGAGTACTTCACGTTTCGCGAGAAGTTCCTGTTCGTGGACCTGTGCGGACTGGACGTCACG
AAGCTGCCGGAGCGCTCGACGCAGTTCGAGCTGGAGATCGTGCTGAAGCATGCGTATCCATCGGACCAAC
GCTTCAGCGCTGAAAACGTGCGGCTATTCTGCTCGCCCGTGATCAACCTGTTCGAGCTGGATGCCGAGCC
GATCGAGATCGACCATCATCAAACCGAATACCGCGTGGTGCCGGCCGGGCATCAAGGCGAACACGTCGAA
ACGTATTCCGTCGACGCGATCGACGCGTTCGACCACGAAACGGCCGAGCGGTATGAATACGTGCCGTTTG
CAACGTTCCGCCACCGCGGCGGCATGCTGCGCCACGAGGCGCCGGAGCGGTATTTCCACACGCGTGTGCG
GCCGGGCGTTTCCGGGCTGCACGAAACGTGGGTGATTCTCGGCGGCCATGCATGGGAAACGATGGACGCG
CTGCCCGAGGAAAGCCTGTCGCTGCGCGTGACCGGCACGAACGGGTTGCTGCCGCGCAAGGGACTGCGCG
AAGCGAGCCTGAACGAGCTCGCGACCAGCACGCAAAACGTCGCAGGTGTGCGCAATCTCGTTTCGCCGAC
CTTGCCGCTGTATCCGCCGACGGAAGACCGCTTCCAGTGGCGCGTGCTGTCGCATCTCGCGCCGAACTTC
CTGTCGATGATGAACGCGGAAGTGCTGCGCGGGGCGCTCGCGCTGTACGACTGGACCAACGACGAACTGA
ACCGCCGACGTCTCGCGGGCATCTTGTGGGTGTCACAGGAACTGATCGAGGAAGTGTCGGGCGGCGCGGT
CGAGCGAGGGGTGTCGATCGAGGTGACGCTCGACAGCCACGCGTTCGCCGGCGACGGCGACGTGATGCTG
TTCGGCGAGCTGCTGCACCGATTCTTCGCGCTCTACGCCGACATCAACCTGTTCACGAAGCTCGCGATCG
TCAGCCTGCCGGCGCAGGCGCGCACCGAATGGCCCCGCAGCAAGGCCGAGCGGGCGCCGCTATGA
 Primer design