SecReT6
Protein ID: 387906491
SecReT6 ID661
T6SS typei2
Gene symbol-
Locus tagMYA_5760
StrainBurkholderia sp. KJ006
Repliconchromosome III [GenBank: NC_017922] [Browse all T6SS(s) in this replicon]
Location [Strand]788164..789744 [-]
ProductType VI secretion-associated protein, VC_A0119 family
NoteTssA
UniProt IDI2DZM1
KEGG IDbuk:MYA_5760
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 2.00E-20, Aligned region: 68..125
ImpA-rel_N [PF06812], Evalue: 2.00E-20, Aligned region: 398..414
Protein Sequence: 526 a.a.     [Download]
>gi|387906491|ref|YP_006336828.1| Type VI secretion-associated protein, VC_A0119 family [Burkholderia sp. KJ006]
MKLGGLFQKLFPARVDAEQLVQARLDAWNAWLLPLAGDGGVGRDPGYEDMFFELREETQKLSGIDDGLIV
RSCEQLLKETGKDLRLAGYYAFARLRQDGPAGFADALELAAALVDRFGEAVLPARAEAKKGALEMLATAR
VVDLLDSRGAFLPADLERALAALDVLVAGTSTWPEAARPNLQPLVVRFERSGEPVRSAEAEAVASTIPFA
STSTSTIASTRDLLDQARAMAVWLRDQENGYLPSVRLVRSVRWDTLHEVPPTDAAARTRLVPPRGELRQQ
MKRLVLQKQWHELLERVEGAFMEGVNHLWFDLQYFQHVALDHVGAPHNAWSELLRADFALFLERLPGIER
LAFNDGTPFAEDATLEWIARHAVVRDLEAGEAVAPLPVSADSEGDAGDWPEIEAQARDLAVREGVEAAFA
WLEALPGMKTDRHRYLQRLVMARLADHAGRPDTAHALLAELDMHSRSLPLVRWEPALVFEVKQQLVRALK
AMSARKDADKPTLARRIGELQAELTVLDPGRALTLS
 
Nucleotide Sequence: 1581 bp     [Download]
>gi|387905813|ref|NC_017922.1|:c789744-788164 Burkholderia sp. KJ006 chromosome 3, complete sequence
ATGAAACTCGGCGGACTGTTCCAGAAGCTTTTCCCTGCTCGCGTCGACGCCGAGCAGTTGGTGCAAGCCA
GGCTCGATGCCTGGAATGCGTGGTTGCTGCCGCTTGCGGGCGACGGCGGCGTCGGCCGCGATCCAGGCTA
CGAGGACATGTTTTTCGAACTGCGCGAGGAGACGCAGAAGCTTTCCGGCATCGACGACGGCCTCATCGTC
AGGTCCTGCGAGCAATTGCTCAAGGAAACCGGCAAGGATCTGCGTCTGGCCGGCTACTACGCATTTGCGC
GGCTGCGGCAGGACGGCCCCGCAGGCTTCGCGGACGCGCTCGAACTCGCGGCCGCGCTCGTCGATCGTTT
CGGCGAGGCCGTGCTGCCCGCGCGCGCGGAGGCGAAGAAGGGCGCGCTCGAAATGCTCGCCACCGCACGT
GTGGTCGACCTGCTCGACAGCCGCGGCGCATTCCTGCCGGCCGACCTCGAGCGTGCACTCGCCGCGCTCG
ATGTGCTCGTCGCGGGGACGAGCACATGGCCGGAAGCCGCGCGTCCGAACCTGCAACCGCTCGTCGTGCG
TTTCGAGCGCAGCGGCGAACCCGTGCGCAGCGCGGAGGCGGAAGCGGTTGCGTCGACGATACCGTTCGCG
TCGACGTCGACGAGCACCATCGCATCGACACGCGACCTGCTGGATCAGGCGCGTGCGATGGCGGTCTGGT
TGCGCGATCAGGAGAACGGCTACTTGCCGTCGGTCCGGCTCGTGCGCAGCGTCCGCTGGGACACGCTGCA
CGAGGTGCCGCCGACGGACGCCGCCGCACGTACGCGGCTCGTGCCGCCTCGCGGCGAGCTGCGCCAGCAG
ATGAAGCGGCTGGTCTTGCAGAAGCAGTGGCACGAACTGCTCGAACGCGTCGAAGGGGCGTTCATGGAGG
GCGTGAATCACCTCTGGTTCGATCTCCAGTATTTCCAGCACGTCGCGCTCGACCATGTCGGTGCGCCCCA
TAACGCGTGGAGCGAGCTGCTGCGCGCGGACTTCGCGCTATTCCTCGAGCGCCTGCCCGGCATCGAGCGG
CTGGCATTCAACGACGGCACGCCGTTCGCCGAAGACGCGACGCTCGAATGGATTGCGCGCCACGCGGTCG
TGCGCGACCTCGAAGCGGGCGAGGCCGTGGCGCCGTTGCCGGTGTCGGCCGATAGCGAAGGCGATGCCGG
CGACTGGCCGGAAATCGAAGCGCAAGCGCGGGATCTCGCCGTGCGCGAAGGCGTGGAGGCGGCATTCGCG
TGGCTCGAGGCGCTGCCCGGCATGAAGACCGATCGTCATCGCTACCTGCAGCGGCTCGTGATGGCGCGCC
TGGCCGATCATGCCGGCCGGCCCGATACCGCGCACGCCCTGCTTGCCGAGCTCGATATGCATTCGCGATC
GCTGCCGCTGGTCCGCTGGGAGCCGGCGCTGGTTTTCGAGGTCAAGCAGCAACTCGTGAGGGCGTTGAAA
GCGATGAGTGCCCGCAAGGACGCCGACAAGCCGACGCTTGCGCGCCGCATCGGCGAACTGCAGGCCGAGC
TTACCGTGCTCGATCCCGGTCGGGCACTGACACTTTCATAA
 Primer design