SecReT6
Protein ID: 387906492
SecReT6 ID661
T6SS typei2
Gene symbol-
Locus tagMYA_5761
StrainBurkholderia sp. KJ006
Repliconchromosome III [GenBank: NC_017922] [Browse all T6SS(s) in this replicon]
Location [Strand]789741..792617 [-]
Producthypothetical protein
NoteTssM
UniProt IDI2DZM2
KEGG IDbuk:MYA_5761
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 5.30E-74, Aligned region: 196..521
DUF1215 [PF06744], Evalue: 5.50E-35, Aligned region: 28..48
DUF1215 [PF06744], Evalue: 5.50E-35, Aligned region: 239..261
DUF1215 [PF06744], Evalue: 5.50E-35, Aligned region: 656..774
Protein Sequence: 958 a.a.     [Download]
>gi|387906492|ref|YP_006336829.1| hypothetical protein MYA_5761 [Burkholderia sp. KJ006]
MNVTDFGSETSSPDEAIGFTWSNARVNAAEIDASLQDLAYCLAEAGVVRLTKDAHDRYPAELSQHISNLS
GALSGLVVQTTHSRAWRHAIHGLLFAPLFKERELAPAAPVDANGDEPAVGPQHRTIWQTVGEHSRKIHGR
RVGFSLSTAAAWFATALMGCWIAGTTLSGFVNRATIQDAADTVTNLAMVQDRTRALQGLNDLDRQVDTLE
FHQREGAPWTSRFGLNRDAALLDALWPNYADAASRILVGPIRQKLEERLHQLASLSDAQIASGGNTQIQA
SYDTLKAYLMLAKPQRAVAPFLTPLLAATAVPSRPANSTMSSGAWEDLRLHAIAFFATHLGRDTASNTSA
LAIVPDGNLIASTRQTVIGVRGIQNSTDALYRQIVDEATPKYSPITLATLLGDTTSRGLFNTTANVPGVF
TRAAWEERISKSIDDASAQRDVSGDWVLSDAKASNQTPSTLKAELRQRYFEDYARAWALFLNSLRWQSAP
TLSATADQLTLLGDPQRSPLVALMNAVVYQAGTGANTQSLSDSLINKAQQLVGATEKDPAKQAQPPLAPL
AAAFGPILRLTGSDLVSGAPANGKAAAQLAATGDLSLARYLERVTAMRLKASQIVAGADPDAIARLAAQS
VLQGKTSDIADSRDYASRVAASLGEQWSGFGELLRAPFDQSWQVVVQPAASSLNEIWRTAIVADWNKTFG
ARYPFADSDNDASLPEMARFMRPDNGVIAQFVATQLAGVVERQGDRWVAAQGADHGALTIDPSFLNALNK
LTRISTVLFPAGDAHVRYELQAVPTPGVTDMKFVLSGRELHYFNQKQEWMPFEWPGQSLENLSHIEWQTE
RGGLRTALDSQGRFGLIRLLERAKVSQQDSARYLLTWTPDTSQGIPLKVQLRSEAGAGPLDVLQLRNFTL
PARVFLTGSAKSGPKLSGASPPPLPRSMIEAAKHAAVPLPRGALSEVE
 
Nucleotide Sequence: 2877 bp     [Download]
>gi|387905813|ref|NC_017922.1|:c792617-789741 Burkholderia sp. KJ006 chromosome 3, complete sequence
GTGAACGTCACCGACTTCGGTAGCGAAACGTCAAGCCCCGACGAAGCGATCGGGTTCACTTGGTCAAACG
CGCGCGTGAACGCAGCCGAGATCGACGCGTCGCTGCAAGACCTCGCTTACTGCCTCGCGGAGGCCGGCGT
CGTGCGTCTCACCAAAGATGCTCACGACCGCTACCCCGCTGAGCTATCGCAACATATCTCGAACCTGAGC
GGAGCACTGTCCGGTCTCGTCGTGCAAACCACCCACTCCCGTGCCTGGCGACATGCCATTCACGGCCTGC
TGTTCGCGCCGCTATTCAAGGAACGGGAGTTGGCGCCGGCGGCGCCCGTCGACGCCAACGGCGACGAGCC
AGCGGTCGGCCCGCAACATCGAACCATCTGGCAGACCGTCGGCGAGCACAGCCGCAAGATTCACGGCCGC
CGAGTAGGCTTCTCGCTTTCTACCGCGGCCGCATGGTTCGCAACGGCCCTCATGGGTTGCTGGATCGCTG
GCACGACGCTGTCCGGATTCGTCAACCGTGCAACGATTCAGGACGCGGCAGACACGGTCACGAATCTCGC
CATGGTGCAGGATCGCACACGGGCATTACAGGGCTTAAATGACCTGGATCGACAAGTCGACACGCTCGAA
TTCCACCAACGCGAAGGCGCCCCATGGACGTCGCGGTTCGGTCTGAACCGCGATGCCGCGCTGCTCGACG
CGCTCTGGCCAAACTATGCCGATGCTGCGAGCCGCATCCTGGTTGGCCCGATCCGTCAGAAGCTCGAGGA
ACGCCTGCATCAGCTCGCGTCCCTGTCCGATGCGCAGATTGCCAGCGGTGGCAATACACAGATTCAGGCC
TCCTATGACACGCTCAAGGCTTACCTGATGCTCGCGAAGCCCCAGCGGGCCGTCGCTCCGTTCCTGACGC
CGCTGCTTGCCGCTACGGCCGTGCCTTCACGTCCGGCCAACTCGACCATGTCGTCAGGTGCCTGGGAAGA
TTTGCGTCTCCATGCGATCGCGTTCTTTGCAACGCATCTCGGCCGAGACACCGCGTCGAATACCTCCGCG
CTCGCAATCGTTCCAGACGGCAACCTGATTGCGTCGACCCGCCAAACGGTAATTGGCGTGCGCGGCATCC
AGAATTCGACGGATGCGCTCTACCGCCAGATCGTCGACGAAGCTACGCCCAAGTACTCGCCGATTACCCT
CGCCACGCTGCTCGGCGACACGACGAGTCGTGGCCTGTTCAACACGACGGCGAACGTCCCCGGCGTTTTC
ACGCGCGCCGCGTGGGAAGAACGCATTTCGAAATCGATCGACGACGCCAGCGCGCAGCGCGACGTGTCGG
GCGACTGGGTGCTGTCTGACGCAAAGGCCAGCAACCAGACGCCGTCGACGCTGAAGGCCGAACTGCGCCA
GCGCTACTTCGAGGATTACGCGCGCGCGTGGGCGCTATTCCTCAACAGCCTGCGCTGGCAATCTGCACCG
ACGCTGTCGGCGACAGCCGATCAATTGACGCTGCTGGGCGACCCGCAGCGCTCGCCGCTCGTCGCGTTGA
TGAACGCGGTCGTCTACCAGGCGGGCACGGGCGCGAATACGCAGTCGCTGTCGGACAGCCTGATCAACAA
GGCGCAGCAGCTCGTCGGCGCGACGGAGAAAGATCCGGCGAAGCAGGCCCAGCCGCCGCTCGCGCCGCTG
GCCGCCGCCTTTGGTCCGATCTTGCGCTTGACCGGCAGCGATCTGGTGTCGGGCGCCCCGGCAAACGGCA
AGGCAGCCGCGCAACTCGCCGCGACCGGCGACCTGAGTCTCGCGCGCTACCTTGAGCGCGTGACCGCGAT
GCGTCTGAAAGCATCGCAAATCGTCGCCGGCGCAGATCCGGACGCGATCGCGCGCCTCGCTGCGCAGTCC
GTGCTGCAAGGCAAGACATCCGACATCGCCGACAGCCGCGACTACGCGAGCCGCGTGGCCGCGAGCCTCG
GCGAACAATGGTCGGGTTTCGGCGAACTGCTTCGCGCACCGTTCGATCAATCCTGGCAGGTCGTCGTGCA
ACCGGCCGCGTCGAGCCTGAATGAAATCTGGCGCACGGCGATCGTGGCCGACTGGAACAAGACGTTCGGT
GCGCGCTATCCATTTGCAGACTCGGACAACGACGCGTCGCTGCCCGAAATGGCGCGCTTCATGCGGCCCG
ACAACGGCGTGATCGCTCAGTTCGTCGCGACGCAGCTGGCCGGCGTCGTCGAACGGCAGGGCGACCGTTG
GGTGGCCGCGCAAGGAGCCGACCATGGCGCGTTGACGATCGATCCATCCTTTCTGAACGCGCTGAACAAG
CTGACGCGCATCTCGACCGTGCTGTTCCCGGCCGGCGACGCGCACGTGCGCTACGAACTGCAAGCGGTAC
CCACACCGGGCGTGACCGACATGAAGTTCGTGCTGTCCGGCCGCGAACTGCATTACTTCAACCAGAAGCA
GGAATGGATGCCGTTCGAATGGCCGGGCCAGTCACTGGAGAATCTGTCGCACATCGAATGGCAGACCGAG
CGCGGCGGTCTGCGCACCGCGCTGGATTCGCAAGGCCGCTTCGGCCTGATCCGGCTGCTGGAGCGCGCAA
AGGTGTCGCAGCAGGACAGCGCGCGCTATCTGCTGACCTGGACGCCCGATACGAGCCAGGGCATTCCGCT
CAAGGTTCAGTTGCGCAGCGAGGCCGGCGCGGGTCCGCTCGACGTGCTGCAGCTGCGCAATTTCACGTTG
CCGGCGCGGGTTTTCCTGACGGGTTCGGCCAAGTCGGGACCGAAACTTTCGGGCGCGAGTCCGCCGCCGC
TGCCTCGGTCGATGATCGAAGCGGCGAAGCATGCCGCGGTACCGCTCCCGCGTGGCGCATTGTCGGAGGT
CGAATGA
 Primer design