SecReT6
Protein ID: 387906495
SecReT6 ID661
T6SS typei2
Gene symbol-
Locus tagMYA_5764
StrainBurkholderia sp. KJ006
Repliconchromosome III [GenBank: NC_017922] [Browse all T6SS(s) in this replicon]
Location [Strand]799113..801452 [-]
ProductVgrG protein
NoteTssI
UniProt IDI2DZM5
KEGG IDbuk:MYA_5764
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 8.30E-54, Aligned region: 30..350
DUF2345 [PF10106], Evalue: 2.40E-35, Aligned region: 603..744
T6SS_Vgr [PF13296], Evalue: 4.50E-26, Aligned region: 481..585
T6SS_Vgr [PF13296], Evalue: 4.50E-26, Aligned region: 620..642
Phage_base_V [PF04717], Evalue: 1.70E-11, Aligned region: 109..159
Phage_base_V [PF04717], Evalue: 1.70E-11, Aligned region: 415..474
Protein Sequence: 779 a.a.     [Download]
>gi|387906495|ref|YP_006336832.1| VgrG protein [Burkholderia sp. KJ006]
MSMILPSQAYELKLAPHPAPTSVLRFTGRDAVSELYHYDIEFTSPVAGIPMDQVVGRPAKFIVSPVDPNM
NYLRRMFGENAEQFSALPTAYTIHGIITEFDEFGTSNDQTHYRVRLEPKLADLNRGVTSRLFQKQSVDEI
VTDTLRHYGYRAGVDFQFQLRDQYKRREYVTQYHETTFAFIRRICTEEGIWFRWEQKKDHAVLVFGDDLD
AYSRKQRTLAYRRDAGLESSGADAIKTLDKRTRRVPEAVRLHDYNHRQAGVSLLVEENAARDDKTTSGID
YSWGEHYETPEEGKCVARRRHEEFLAAQITFKGTGNPFWLEAGEVMRLEPNPSDAKHGIFVTSVESHGGR
DQSYWVTFEGIPSDRVWRTAMASISKPAVDGILPARITSPGNYKYAYLTEQGWYVIKLPFDLDEWSPGGT
SRPVRFAKPYSGDNYGHHFPLIDGAEVAIVFTDGHPDRPVIIGAMHDSLHPDLVNNLNHTRNLIVTAAGN
TQRMEDREGNEHVHLMSPFQASELTLGHMVDLDRKERGKGAELRTDGPAALRGAKGVLVSAEGQPGAAGQ
QLAMQDADMTLEQAEQILRALNDSANAAKALQADIDQQRVLIQQKLKGLQKPVIMATAPEGLGLTTGGQM
QLASRKQMFVTAGDGLDVGVVKRIAIAAGETISLFAAKLGIRIFAAKGKVQVQAQSDAMELMSMLDMVVS
SSDGEAIITGRKGVTIGDGSGAYIKLAGGQIILGSPAGEIELKGNLKVDDPDGGSFKFPTWSKVPLNDVK
AATNFGFSE
 
Nucleotide Sequence: 2340 bp     [Download]
>gi|387905813|ref|NC_017922.1|:c801452-799113 Burkholderia sp. KJ006 chromosome 3, complete sequence
ATGTCGATGATATTGCCGTCACAGGCTTACGAACTGAAGCTGGCGCCGCACCCGGCGCCGACCTCCGTCC
TCCGCTTCACCGGGCGGGACGCGGTGAGCGAGTTGTACCACTACGACATCGAGTTCACGAGCCCGGTGGC
AGGTATACCGATGGACCAGGTGGTTGGCCGCCCGGCGAAGTTCATCGTCTCGCCGGTCGATCCGAACATG
AACTATCTGCGCAGGATGTTCGGCGAGAATGCGGAGCAGTTCAGCGCGTTGCCGACGGCGTATACGATCC
ACGGCATCATCACCGAGTTCGACGAGTTCGGCACCTCGAACGATCAGACGCATTATCGGGTTCGGCTCGA
GCCCAAACTCGCCGACCTGAACCGCGGTGTGACGAGCCGACTGTTTCAGAAGCAGTCGGTCGACGAAATC
GTGACCGACACGCTGCGTCATTACGGCTACCGGGCAGGCGTCGATTTCCAGTTCCAGCTTCGTGACCAGT
ACAAGCGTCGCGAGTACGTCACTCAGTATCACGAGACCACGTTTGCCTTTATCCGGCGCATTTGTACGGA
GGAGGGAATCTGGTTTCGCTGGGAGCAGAAGAAGGATCACGCCGTGCTCGTGTTCGGCGACGATCTGGAT
GCCTATTCGCGCAAGCAACGTACGTTGGCGTACCGGCGCGACGCGGGGCTCGAGAGTTCGGGTGCCGACG
CGATCAAGACGCTCGACAAGCGCACCAGGCGCGTACCCGAAGCCGTGCGGCTGCACGATTACAACCACCG
GCAGGCCGGTGTGTCGCTGCTGGTCGAGGAAAATGCTGCGCGCGACGACAAGACGACGAGCGGCATCGAT
TACAGCTGGGGCGAGCACTACGAGACGCCGGAGGAAGGCAAGTGTGTCGCTCGCCGGCGGCATGAGGAGT
TTCTGGCTGCGCAGATCACCTTCAAGGGCACCGGTAATCCGTTCTGGCTCGAGGCGGGTGAAGTCATGCG
GCTCGAGCCCAATCCGTCCGACGCGAAGCATGGGATCTTCGTCACGTCGGTGGAGTCGCACGGCGGCCGC
GATCAGTCGTATTGGGTGACCTTCGAGGGGATTCCTTCCGATCGCGTGTGGCGTACGGCGATGGCGTCGA
TATCAAAGCCAGCCGTCGACGGCATTCTGCCGGCTCGCATCACTTCGCCGGGCAACTACAAATATGCGTA
CTTGACCGAGCAAGGCTGGTACGTGATCAAGCTGCCGTTCGACCTCGATGAATGGAGTCCGGGTGGGACG
AGCCGGCCGGTGCGGTTCGCGAAGCCTTATAGCGGCGACAACTATGGGCATCACTTCCCGTTGATCGATG
GGGCGGAGGTGGCGATCGTCTTTACCGACGGTCATCCGGATCGGCCCGTGATCATCGGGGCCATGCATGA
CAGTTTGCATCCGGATCTCGTCAACAACCTCAATCACACGCGGAATCTCATTGTGACTGCTGCGGGGAAT
ACGCAGCGGATGGAGGACAGAGAAGGCAACGAACATGTCCATCTGATGAGCCCGTTCCAGGCCAGTGAGC
TCACTCTCGGTCATATGGTCGACCTCGATCGCAAGGAGCGCGGAAAAGGCGCGGAGTTGCGCACGGATGG
ACCTGCGGCACTGCGGGGAGCAAAAGGGGTGCTGGTCAGCGCGGAGGGGCAACCTGGTGCGGCGGGCCAG
CAACTCGCCATGCAGGATGCCGACATGACGCTCGAGCAGGCCGAACAAATTCTGCGTGCGCTTAATGATT
CGGCGAATGCTGCGAAGGCATTGCAGGCTGATATCGATCAACAGCGCGTACTGATCCAGCAAAAACTCAA
GGGCCTGCAGAAGCCGGTAATTATGGCGACGGCTCCGGAAGGGTTGGGCCTTACGACCGGCGGACAGATG
CAACTCGCGTCTCGCAAGCAGATGTTCGTTACCGCAGGCGACGGACTCGATGTCGGCGTCGTGAAGCGTA
TCGCCATCGCTGCCGGTGAGACGATCTCGCTTTTCGCTGCGAAGCTGGGCATCCGGATTTTTGCTGCGAA
GGGCAAGGTACAAGTGCAAGCGCAGTCCGACGCGATGGAATTGATGTCGATGCTGGATATGGTCGTTAGT
TCATCGGATGGCGAAGCAATCATTACGGGCCGCAAAGGCGTCACGATTGGAGACGGCTCTGGCGCCTACA
TCAAGCTCGCGGGCGGCCAGATCATCCTGGGCAGCCCGGCCGGAGAAATTGAACTCAAGGGCAACCTGAA
AGTTGACGATCCTGACGGTGGCAGCTTCAAGTTCCCCACATGGTCCAAGGTGCCGCTCAACGATGTGAAG
GCCGCAACGAATTTCGGATTTTCTGAGTAA
 Primer design