SecReT6
Protein ID: 387906496
SecReT6 ID661
T6SS typei2
Gene symbol-
Locus tagMYA_5765
StrainBurkholderia sp. KJ006
Repliconchromosome III [GenBank: NC_017922] [Browse all T6SS(s) in this replicon]
Location [Strand]801536..803068 [-]
ProductType VI secretion protein, EvpB/VC_A0108 family
NoteTssC
UniProt IDI2DZM6
KEGG IDbuk:MYA_5765
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 5.40E-177, Aligned region: 85..506
Protein Sequence: 510 a.a.     [Download]
>gi|387906496|ref|YP_006336833.1| Type VI secretion protein, EvpB/VC_A0108 family [Burkholderia sp. KJ006]
MKQNEASQGASETVVLENDSVYAALCNKINLKPVAEARPLEAFRDNDTLSEASADERVARGMDALLNLIA
KESKPVERLDKSLLDFYIGQLDRQISRQLDAVMHSSEFQALEGRWRGLKMLVSRTDFRKNARIEVLDVSK
DALQRDFEDTPELIQSGLYRLTYIEEYDTPGGQPISAMVSDFEFTHSPQDVALLRNISKVAAAAHMPFIG
AVGAAFFGKKSMEEVAAIQDIGNYFDRAEYIKWKSFRDTDDARYVGLTMPRVLGRLPYGKDTTPVRAFNY
EEAVKGPDHDKYLWVNASFAFAANMVRSFVSNGWCVQIRGPQAGGKVEDLPVHLYDLGTGVQPKIPTEVL
IPETREFEFANLGFIPLSFYKNHDFACFFSASSTQKPALYETKEATANSRINARLPYIFLLSRIAHYLKL
IQRENIGTTKDRRLLELELNNWIKGLVTEMKDPGDELQASHPLREAKVTVEDIEDNPGFFRIKLFIIPHF
QVEGMDIGLSLVSQMPKAKG
 
Nucleotide Sequence: 1533 bp     [Download]
>gi|387905813|ref|NC_017922.1|:c803068-801536 Burkholderia sp. KJ006 chromosome 3, complete sequence
ATGAAGCAAAATGAAGCGAGCCAGGGCGCATCGGAAACGGTGGTGCTCGAAAACGACAGCGTCTACGCTG
CGCTGTGCAACAAGATCAACCTGAAGCCGGTGGCCGAAGCGCGGCCGCTCGAGGCGTTCCGCGACAACGA
CACGCTGTCGGAGGCATCGGCCGACGAACGCGTCGCGCGCGGGATGGACGCGCTGCTCAACCTCATCGCG
AAGGAGAGCAAGCCGGTCGAGCGGCTCGACAAATCGCTGCTCGACTTCTACATCGGCCAGCTCGACCGGC
AGATCAGCCGGCAGCTCGACGCGGTCATGCATTCGTCGGAATTCCAGGCGCTCGAGGGCCGCTGGCGCGG
CTTGAAGATGCTGGTTTCGCGCACCGACTTCCGCAAGAACGCGCGAATCGAAGTGCTCGACGTGTCGAAG
GATGCGCTGCAGCGCGACTTCGAGGACACGCCCGAACTGATCCAGAGCGGCCTGTACCGCCTCACCTACA
TCGAGGAATACGACACGCCGGGCGGCCAGCCGATCAGCGCGATGGTCAGCGACTTCGAGTTTACGCATTC
GCCGCAGGACGTCGCGTTGCTGCGCAACATCTCGAAGGTTGCGGCCGCGGCGCACATGCCGTTCATCGGG
GCGGTCGGCGCCGCGTTCTTCGGCAAAAAGTCGATGGAAGAGGTCGCTGCGATTCAGGACATCGGCAACT
ACTTCGATCGCGCCGAATACATCAAGTGGAAGAGCTTCCGCGACACGGACGATGCGCGCTACGTCGGCCT
GACGATGCCGCGCGTGCTCGGTCGCCTGCCGTACGGCAAGGACACGACGCCGGTGCGCGCCTTCAACTAT
GAAGAGGCGGTGAAAGGCCCGGACCACGACAAGTACCTGTGGGTCAATGCGTCGTTCGCGTTCGCGGCCA
ACATGGTGCGCAGCTTCGTGAGCAATGGGTGGTGCGTGCAGATCCGCGGCCCGCAGGCAGGCGGCAAGGT
CGAGGACCTGCCGGTGCACCTGTATGACCTCGGCACCGGCGTGCAGCCGAAGATTCCGACCGAAGTGCTG
ATCCCGGAGACGCGCGAGTTCGAATTCGCCAACCTCGGCTTCATTCCGCTGTCGTTCTACAAGAACCACG
ATTTCGCGTGCTTCTTCTCGGCGAGCTCGACGCAGAAGCCGGCGCTGTACGAGACCAAGGAGGCGACGGC
CAACAGCCGCATCAATGCGCGGTTGCCGTACATCTTCCTGCTGTCGCGCATCGCCCATTACCTCAAGCTG
ATTCAGCGCGAGAACATCGGTACGACGAAGGACCGGCGTCTGCTCGAGCTCGAGCTGAACAACTGGATCA
AGGGCCTCGTGACCGAGATGAAGGATCCGGGCGACGAGCTGCAGGCATCGCATCCGTTGCGCGAGGCGAA
GGTGACGGTCGAGGACATCGAGGACAACCCGGGATTCTTCCGCATCAAGCTGTTCATCATTCCGCACTTC
CAGGTGGAGGGGATGGATATCGGGCTGTCGCTGGTGTCGCAGATGCCGAAGGCGAAGGGCTGA
 Primer design