SecReT6
Protein ID: 387906497
SecReT6 ID661
T6SS typei2
Gene symbol-
Locus tagMYA_5766
StrainBurkholderia sp. KJ006
Repliconchromosome III [GenBank: NC_017922] [Browse all T6SS(s) in this replicon]
Location [Strand]803142..803654 [-]
ProductType VI secretion protein, VC_A0107 family
NoteTssB
UniProt IDI2DZM7
KEGG IDbuk:MYA_5766
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 1.50E-54, Aligned region: 5..157
Protein Sequence: 170 a.a.     [Download]
>gi|387906497|ref|YP_006336834.1| Type VI secretion protein, VC_A0107 family [Burkholderia sp. KJ006]
MDSFQREIPKSRVSITLDLHTGGAQKKVELPLKLLVAGDFSAGREQAPLAERKKVNIDKNNFDAVLADYA
PDLKIAADNTLADDGTELPVNLSFRSMKDFEPEQVARQIPELQAMLAMRNLLRDLKSNLLDNGTFRREFE
KILKDKRLTAKLRGELAQIVTAATQQEGHA
 
Nucleotide Sequence: 513 bp     [Download]
>gi|387905813|ref|NC_017922.1|:c803654-803142 Burkholderia sp. KJ006 chromosome 3, complete sequence
ATGGATAGCTTCCAGAGAGAGATTCCGAAGAGTCGCGTTTCAATTACGTTGGATTTGCATACGGGCGGGG
CTCAGAAGAAGGTCGAGCTGCCGTTGAAGTTGCTGGTCGCGGGCGACTTCAGTGCGGGCCGTGAGCAGGC
GCCGCTGGCCGAGCGAAAGAAGGTCAATATCGACAAGAACAACTTCGATGCCGTTCTGGCCGACTACGCG
CCGGATCTGAAGATCGCGGCGGACAATACGCTGGCCGACGACGGCACGGAACTGCCGGTGAATCTTTCGT
TCCGCTCGATGAAGGATTTCGAGCCGGAGCAGGTCGCGCGCCAGATCCCCGAACTGCAGGCGATGCTGGC
GATGCGCAATCTGCTGCGCGACCTGAAGTCGAATCTGCTCGACAACGGCACGTTCCGTCGCGAGTTCGAG
AAGATCCTGAAGGACAAGCGCCTCACGGCGAAACTGCGCGGCGAGCTGGCGCAGATCGTCACGGCCGCGA
CGCAACAGGAAGGTCATGCCTGA
 Primer design