SecReT6
Protein ID: 387906498
SecReT6 ID661
T6SS typei2
Gene symbol-
Locus tagMYA_5767
StrainBurkholderia sp. KJ006
Repliconchromosome III [GenBank: NC_017922] [Browse all T6SS(s) in this replicon]
Location [Strand]804249..805601 [+]
ProductType VI secretion protein, VC_A0114 family
NoteTssK
UniProt IDI2DZM8
KEGG IDbuk:MYA_5767
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.70E-125, Aligned region: 18..447
Protein Sequence: 450 a.a.     [Download]
>gi|387906498|ref|YP_006336835.1| Type VI secretion protein, VC_A0114 family [Burkholderia sp. KJ006]
MRIDKPLWHEGLILTQQHFQQQDRWAEFALRQYASAAIAEPWGTLAVEIDEEALATSRLKLTRLRLCFPD
GTPIDTTIADSLPPARDLTRGVPTDLQSVVVLAALALPDANGSNCRFDEAVLARPRRSYREFVKVPDLNG
TTETEIAAERHAVRLLFDFESHADDTVCAIARLTRGSSGQFQVDHRFVPPCLTLGSHPLHLERIHRIADI
LHAKSLALGARRSERLEQVAEYGVADVQLFWLLHCIHAAWPQLRLFVTHPSRSPEQLYATLAQLASALIT
FSTTVQLTDIPAYDHSRADEVFARLETMIRELLDAIIPSRVVSIGLTRNGPTTWTGQFLDERIVADAADW
YLSVNAPMPAFELAEQFPRLCKIGAPDDVEHIINSALLGVPLKAVQRVPSAIPVRLDNHYFALDSASVVH
RKMLAARACQIYLPASIPDASLELYAVLRS
 
Nucleotide Sequence: 1353 bp     [Download]
>gi|387905813|ref|NC_017922.1|:804249-805601 Burkholderia sp. KJ006 chromosome 3, complete sequence
ATGCGAATCGATAAGCCACTTTGGCACGAGGGCCTAATCCTGACTCAGCAGCATTTTCAGCAGCAGGACA
GATGGGCTGAATTTGCGTTACGTCAGTACGCCTCTGCGGCAATTGCGGAACCGTGGGGCACACTCGCCGT
CGAGATCGACGAAGAAGCCCTGGCGACAAGCCGCCTGAAACTCACCCGTCTGAGACTGTGCTTTCCCGAC
GGCACCCCGATCGACACGACGATCGCCGATTCGCTGCCGCCCGCGCGCGACCTGACGCGAGGTGTGCCGA
CCGATCTTCAAAGCGTCGTGGTGCTCGCGGCGCTTGCGCTGCCCGATGCAAACGGCAGCAATTGCCGCTT
CGACGAAGCCGTGCTCGCCCGTCCGCGGCGCTCGTACCGGGAGTTCGTCAAGGTCCCCGATCTGAATGGC
ACCACCGAGACCGAAATCGCAGCCGAACGGCATGCGGTGCGGCTGCTGTTCGACTTCGAGTCGCACGCCG
ACGACACGGTCTGCGCGATCGCGCGGCTGACGCGCGGCTCGAGCGGTCAATTCCAGGTCGATCACCGGTT
CGTGCCGCCGTGCCTGACGCTCGGCAGCCATCCGCTGCATCTCGAACGGATCCACCGCATCGCCGACATC
CTGCACGCCAAGAGCCTCGCGTTAGGCGCTCGCCGCAGCGAGCGCCTCGAGCAAGTCGCCGAATATGGCG
TGGCCGACGTGCAACTTTTCTGGCTGCTGCACTGCATTCACGCAGCGTGGCCGCAACTGCGCCTCTTCGT
GACGCACCCCAGCCGGTCTCCTGAACAGCTGTATGCGACGCTCGCTCAGCTGGCGAGCGCGCTGATCACG
TTCTCGACCACGGTGCAGCTCACGGACATTCCCGCCTACGACCACTCGCGCGCCGACGAGGTATTCGCGC
GACTCGAAACGATGATCCGCGAGCTGCTCGACGCGATCATTCCATCACGCGTCGTGTCGATCGGCCTGAC
CCGCAACGGACCGACGACCTGGACCGGCCAGTTCCTCGACGAGCGGATCGTCGCGGATGCGGCCGACTGG
TACCTGTCGGTCAATGCGCCGATGCCTGCATTCGAGCTTGCCGAGCAATTTCCGCGGCTGTGCAAGATCG
GCGCGCCGGACGACGTCGAACACATCATCAACTCCGCGCTGCTCGGCGTTCCGCTGAAGGCGGTGCAGCG
CGTGCCGTCCGCGATTCCGGTACGTCTCGACAATCACTACTTCGCGCTCGATTCGGCCAGCGTCGTGCAC
AGGAAGATGCTTGCCGCACGAGCGTGCCAGATCTATCTGCCCGCGTCGATTCCGGACGCGTCGCTCGAAC
TCTACGCGGTGCTGCGCTCATGA
 Primer design