SecReT6
Protein ID: 387906499
SecReT6 ID661
T6SS typei2
Gene symbol-
Locus tagMYA_5768
StrainBurkholderia sp. KJ006
Repliconchromosome III [GenBank: NC_017922] [Browse all T6SS(s) in this replicon]
Location [Strand]805598..806329 [+]
Producthypothetical protein
NoteTssL
UniProt IDI2DZM9
KEGG IDbuk:MYA_5768
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.90E-46, Aligned region: 28..228
Protein Sequence: 243 a.a.     [Download]
>gi|387906499|ref|YP_006336836.1| hypothetical protein MYA_5768 [Burkholderia sp. KJ006]
MKALKLNRPAAALMQGAAGPGNAPADGIRDLLRDTALLVTTLTSGGQVPDAIALRARCKQLVEQFASALE
RRGFPDDVRNEALVAQCGLLDEAALRHLPAESRSGWEQKPLQVEQFNLHEAGERVFERLDARMREASPSV
ALLECYAAILGMGFVGRYAREGEAKRAALIASLNAKLETLRPPSERPFIADRAGRRLSDWFYRLSPWAIA
GLAVIAAAIVWGVWSAVLDAQLAQLIATKAVRP
 
Nucleotide Sequence: 732 bp     [Download]
>gi|387905813|ref|NC_017922.1|:805598-806329 Burkholderia sp. KJ006 chromosome 3, complete sequence
ATGAAAGCCCTGAAGCTCAATCGACCCGCTGCAGCGCTGATGCAAGGCGCGGCAGGCCCGGGAAACGCGC
CCGCCGACGGCATTCGCGACCTGCTGCGCGATACGGCGCTGCTGGTCACGACGCTGACGTCGGGCGGACA
GGTTCCGGACGCAATCGCCCTGCGCGCCCGCTGCAAGCAGCTCGTCGAGCAGTTCGCGAGCGCGCTGGAG
CGCCGCGGTTTTCCCGACGACGTTCGCAACGAGGCGCTGGTCGCGCAGTGCGGGCTGCTCGACGAGGCCG
CGCTGCGGCATTTGCCTGCCGAATCGCGGTCGGGATGGGAACAGAAGCCGCTGCAGGTCGAACAGTTCAA
CTTGCACGAGGCCGGTGAGCGGGTGTTCGAGCGACTCGACGCGCGCATGCGGGAAGCGTCGCCGTCGGTG
GCCCTGCTCGAGTGCTACGCGGCGATTCTCGGGATGGGCTTCGTCGGCCGCTACGCGCGCGAGGGCGAAG
CGAAACGCGCCGCGTTGATCGCATCGCTCAATGCCAAGCTGGAGACGCTGCGCCCGCCGTCCGAGCGGCC
GTTCATCGCGGATCGTGCCGGGCGGCGTCTCTCCGACTGGTTTTACCGGCTGTCGCCATGGGCCATCGCG
GGCCTCGCCGTGATTGCGGCGGCGATCGTATGGGGCGTCTGGTCCGCCGTGCTCGACGCGCAACTCGCGC
AGCTGATCGCAACGAAGGCCGTCCGCCCGTGA
 Primer design