SecReT6
Protein ID: 387906500
SecReT6 ID661
T6SS typei2
Gene symbol-
Locus tagMYA_5769
StrainBurkholderia sp. KJ006
Repliconchromosome III [GenBank: NC_017922] [Browse all T6SS(s) in this replicon]
Location [Strand]806326..808047 [+]
ProductFlagellar motor rotation protein MotB
NoteTagL
UniProt IDI2DZN0, I2DZN0
KEGG IDbuk:MYA_5769
PDB IDNA
Domain hit(s) vs Pfam OmpA [PF00691], Evalue: 1.40E-19, Aligned region: 252..268
OmpA [PF00691], Evalue: 1.40E-19, Aligned region: 465..561
DUF218 [PF02698], Evalue: 0.003, Aligned region: 144..169
DUF218 [PF02698], Evalue: 0.003, Aligned region: 346..376
DUF218 [PF02698], Evalue: 0.003, Aligned region: 471..540
Protein Sequence: 573 a.a.     [Download]
>gi|387906500|ref|YP_006336837.1| Flagellar motor rotation protein MotB [Burkholderia sp. KJ006]
MKSDLPVLSSASPRTPDRGHEGLGYPSRLMIAFAAVLALAVVWLVLPLGSGVAWGISALVGVAALAMIAW
HTRRLARARGDSAHVLAALGAATADIPVKLRTRMPLVLVTGDGLPALFDRTTETRHAHVGDGGIWLRVDR
VQDLPRLAVAVRQWRDGRAPDGIVLSIAPALHADAEVLSQKLRVVRQAAADAMRMLGVRLPAYVAVYQRL
TCGPLGLSTPEWYGVSSATQLAGGARFEPAMRTAEDQVRRAADARVAATRAAALTSVIGWTQRVVFAALA
DRQQPATGWPLFGAGWIDCGPASDSEKPWERDVNMQARVSRAGSAASPAPWPLPQPLIEAMPRRYWMSPR
LVATFHALALLACAAGAAFWGAARNNEALLNRVGADLGRYAAVPADHHAAQRDALTALVADRDQLDRYAR
TGIPLRLSFGMYRGARLIAPLNDAIASYVPPAPPPAIVTLDSMSLFDSGSARLKPGSNHAMVGALEMINA
HPDKRILVAGHTDDTGDPNANLKLSAARAQAVRDWLVDASGIASTRFAIQGYGMTRPLASNDTAEGRARN
RRVEITLVPDSGK
 
Nucleotide Sequence: 1722 bp     [Download]
>gi|387905813|ref|NC_017922.1|:806326-808047 Burkholderia sp. KJ006 chromosome 3, complete sequence
GTGAAATCCGACCTCCCTGTTCTTTCGTCGGCGTCGCCGCGCACGCCCGACCGTGGCCACGAAGGGCTCG
GCTATCCGTCCCGGCTCATGATCGCGTTCGCCGCGGTGCTGGCGCTCGCGGTGGTTTGGCTCGTGCTTCC
GCTCGGTTCGGGCGTCGCGTGGGGGATCTCGGCATTAGTCGGCGTCGCCGCGCTCGCGATGATCGCGTGG
CACACGCGCAGGCTTGCACGCGCGCGCGGCGACAGTGCGCACGTGCTGGCCGCGCTCGGCGCCGCCACCG
CAGACATTCCGGTGAAGCTGCGCACGCGCATGCCGCTCGTGCTGGTGACCGGAGACGGCCTGCCCGCACT
GTTCGACCGAACGACGGAAACCCGCCATGCGCACGTCGGCGACGGCGGCATCTGGCTGCGCGTCGACCGC
GTGCAGGATCTGCCGCGCCTGGCCGTGGCGGTCAGACAGTGGCGCGACGGCCGCGCGCCGGATGGGATCG
TGCTGTCGATCGCGCCTGCGCTGCACGCGGACGCCGAAGTACTTTCGCAAAAGTTGCGGGTCGTTCGTCA
AGCGGCCGCCGATGCCATGCGCATGTTGGGCGTGCGGCTGCCTGCGTACGTTGCGGTCTATCAGCGGCTC
ACCTGCGGCCCGCTCGGACTGTCGACGCCCGAGTGGTACGGCGTGTCGTCGGCCACGCAGCTGGCAGGCG
GCGCGCGTTTCGAGCCCGCGATGCGCACCGCCGAAGACCAGGTCCGGCGCGCGGCCGACGCCCGCGTTGC
CGCCACGCGCGCCGCCGCGCTGACATCGGTGATCGGCTGGACCCAGCGCGTGGTTTTTGCCGCGCTGGCG
GACCGACAGCAGCCGGCTACCGGGTGGCCGTTGTTCGGCGCCGGCTGGATCGACTGCGGACCGGCCAGCG
ATTCGGAAAAGCCGTGGGAACGCGATGTCAACATGCAGGCGCGCGTGAGCCGCGCGGGCTCGGCCGCGTC
GCCCGCGCCGTGGCCGTTGCCGCAGCCGCTGATCGAAGCGATGCCGCGTCGATACTGGATGTCGCCTCGT
CTCGTCGCCACTTTCCACGCGCTGGCTTTGCTCGCCTGCGCCGCGGGCGCTGCGTTCTGGGGCGCGGCCC
GCAACAACGAGGCGCTGTTGAACCGGGTCGGCGCGGATCTCGGTCGCTATGCGGCGGTCCCGGCCGATCA
TCATGCCGCGCAGCGCGACGCGTTGACGGCGCTCGTCGCCGATCGCGATCAACTCGATCGTTACGCGCGC
ACCGGCATTCCGCTGCGCCTGTCGTTCGGCATGTATCGGGGCGCACGGCTGATTGCGCCGTTGAACGACG
CGATCGCCTCTTACGTGCCGCCTGCCCCGCCGCCGGCGATCGTCACGCTCGACAGCATGTCGCTGTTCGA
CAGCGGCAGCGCACGGTTGAAGCCCGGCTCGAACCACGCGATGGTCGGCGCGCTGGAAATGATCAACGCG
CATCCCGACAAACGCATTCTCGTCGCGGGCCATACCGACGACACGGGCGACCCGAACGCCAACCTGAAGC
TGTCGGCCGCGCGCGCGCAAGCGGTACGCGACTGGCTGGTCGACGCGTCGGGCATTGCGTCGACCCGGTT
TGCGATTCAGGGCTACGGCATGACGCGGCCGCTCGCCAGCAACGATACGGCCGAAGGCCGCGCGCGAAAC
CGTCGCGTGGAAATCACGCTGGTCCCGGACTCGGGCAAATAG
 Primer design