SecReT6
Protein ID: 387906501
SecReT6 ID661
T6SS typei2
Gene symbol-
Locus tagMYA_5770
StrainBurkholderia sp. KJ006
Repliconchromosome III [GenBank: NC_017922] [Browse all T6SS(s) in this replicon]
Location [Strand]808145..808630 [+]
ProductHemolysin-coregulated protein Hcp
NoteTssD
UniProt IDI2DZN1
KEGG IDbuk:MYA_5770
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 7.30E-37, Aligned region: 9..147
Protein Sequence: 161 a.a.     [Download]
>gi|387906501|ref|YP_006336838.1| Hemolysin-coregulated protein Hcp [Burkholderia sp. KJ006]
MAIPAYAWFKDDGGADIKGSVTVQDREGSVEVVAFDHGVHIPTDGNTGKLTGTRVHAPITFTKETDASTP
YLYKAVTSGQTLKSVEIKWYKIDDAGKEKEYFNTKLDNVKIVAVRPKMLDIKIPDYEKHNHLEEVELRYE
TITWSYKDGNIVHKDTWNERS
 
Nucleotide Sequence: 486 bp     [Download]
>gi|387905813|ref|NC_017922.1|:808145-808630 Burkholderia sp. KJ006 chromosome 3, complete sequence
ATGGCAATTCCCGCATATGCGTGGTTCAAGGACGACGGCGGCGCCGACATCAAGGGTTCGGTCACGGTTC
AGGACCGCGAAGGCAGCGTCGAAGTCGTCGCGTTCGATCACGGCGTGCATATCCCGACCGATGGCAACAC
GGGCAAGCTGACGGGCACGCGCGTCCACGCGCCGATCACGTTCACGAAGGAAACCGACGCGTCCACGCCG
TACCTGTACAAGGCGGTGACGAGCGGCCAGACGCTGAAGTCGGTCGAGATCAAGTGGTACAAGATCGACG
ACGCGGGCAAGGAGAAGGAGTACTTCAACACGAAGCTCGACAACGTCAAGATCGTCGCGGTGCGTCCGAA
GATGCTCGACATCAAGATCCCGGACTACGAGAAGCACAATCACCTCGAAGAAGTCGAGCTGCGCTACGAA
ACGATCACCTGGTCGTACAAGGACGGCAACATCGTTCACAAGGACACGTGGAACGAGCGTTCCTGA
 Primer design