SecReT6
Protein ID: 387906502
SecReT6 ID661
T6SS typei2
Gene symbol-
Locus tagMYA_5771
StrainBurkholderia sp. KJ006
Repliconchromosome III [GenBank: NC_017922] [Browse all T6SS(s) in this replicon]
Location [Strand]808770..811493 [+]
ProductType VI secretion ATPase, ClpV1 family
NoteTssH
UniProt IDI2DZN2
KEGG IDbuk:MYA_5771
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 1.10E-41, Aligned region: 243..278
AAA_2 [PF07724], Evalue: 1.10E-41, Aligned region: 488..556
AAA_2 [PF07724], Evalue: 1.10E-41, Aligned region: 623..787
AAA [PF00004], Evalue: 1.60E-18, Aligned region: 245..357
AAA [PF00004], Evalue: 1.60E-18, Aligned region: 628..754
AAA_5 [PF07728], Evalue: 1.80E-16, Aligned region: 245..265
AAA_5 [PF07728], Evalue: 1.80E-16, Aligned region: 327..375
AAA_5 [PF07728], Evalue: 1.80E-16, Aligned region: 489..530
AAA_5 [PF07728], Evalue: 1.80E-16, Aligned region: 627..747
ClpB_D2-small [PF10431], Evalue: 1.20E-14, Aligned region: 138..165
ClpB_D2-small [PF10431], Evalue: 1.20E-14, Aligned region: 794..867
AAA_16 [PF13191], Evalue: 1.60E-12, Aligned region: 222..267
AAA_16 [PF13191], Evalue: 1.60E-12, Aligned region: 290..324
AAA_16 [PF13191], Evalue: 1.60E-12, Aligned region: 496..602
AAA_16 [PF13191], Evalue: 1.60E-12, Aligned region: 597..671
AAA_16 [PF13191], Evalue: 1.60E-12, Aligned region: 691..722
AAA_16 [PF13191], Evalue: 1.60E-12, Aligned region: 766..823
AAA_22 [PF13401], Evalue: 1.20E-07, Aligned region: 244..330
AAA_22 [PF13401], Evalue: 1.20E-07, Aligned region: 510..542
AAA_22 [PF13401], Evalue: 1.20E-07, Aligned region: 626..647
AAA_22 [PF13401], Evalue: 1.20E-07, Aligned region: 689..721
AAA_25 [PF13481], Evalue: 4.30E-07, Aligned region: 245..279
AAA_25 [PF13481], Evalue: 4.30E-07, Aligned region: 300..331
AAA_25 [PF13481], Evalue: 4.30E-07, Aligned region: 623..649
AAA_19 [PF13245], Evalue: 2.50E-06, Aligned region: 242..269
AAA_19 [PF13245], Evalue: 2.50E-06, Aligned region: 625..649
AAA_17 [PF13207], Evalue: 3.90E-06, Aligned region: 245..379
AAA_17 [PF13207], Evalue: 3.90E-06, Aligned region: 398..411
AAA_17 [PF13207], Evalue: 3.90E-06, Aligned region: 627..663
IstB_IS21 [PF01695], Evalue: 1.40E-05, Aligned region: 229..270
IstB_IS21 [PF01695], Evalue: 1.40E-05, Aligned region: 505..532
IstB_IS21 [PF01695], Evalue: 1.40E-05, Aligned region: 627..645
IstB_IS21 [PF01695], Evalue: 1.40E-05, Aligned region: 740..767
Clp_N [PF02861], Evalue: 1.70E-05, Aligned region: 24..74
Sigma54_activat [PF00158], Evalue: 1.90E-05, Aligned region: 227..272
Sigma54_activat [PF00158], Evalue: 1.90E-05, Aligned region: 627..744
Arch_ATPase [PF01637], Evalue: 2.50E-05, Aligned region: 223..271
Arch_ATPase [PF01637], Evalue: 2.50E-05, Aligned region: 626..640
Arch_ATPase [PF01637], Evalue: 2.50E-05, Aligned region: 698..715
NACHT [PF05729], Evalue: 7.10E-05, Aligned region: 245..273
NACHT [PF05729], Evalue: 7.10E-05, Aligned region: 627..650
Zeta_toxin [PF06414], Evalue: 0.00018, Aligned region: 239..273
Zeta_toxin [PF06414], Evalue: 0.00018, Aligned region: 626..667
AAA_18 [PF13238], Evalue: 0.00023, Aligned region: 245..265
AAA_18 [PF13238], Evalue: 0.00023, Aligned region: 628..657
AAA_29 [PF13555], Evalue: 0.00091, Aligned region: 238..261
AAA_29 [PF13555], Evalue: 0.00091, Aligned region: 625..652
Mg_chelatase [PF01078], Evalue: 0.0029, Aligned region: 239..262
Mg_chelatase [PF01078], Evalue: 0.0029, Aligned region: 627..671
DUF258 [PF03193], Evalue: 0.0033, Aligned region: 231..263
DUF258 [PF03193], Evalue: 0.0033, Aligned region: 626..639
RNA_helicase [PF00910], Evalue: 0.0099, Aligned region: 246..267
RNA_helicase [PF00910], Evalue: 0.0099, Aligned region: 628..648
RNA_helicase [PF00910], Evalue: 0.0099, Aligned region: 725..746
Protein Sequence: 907 a.a.     [Download]
>gi|387906502|ref|YP_006336839.1| Type VI secretion ATPase, ClpV1 family [Burkholderia sp. KJ006]
MISRDTTHLLRRLNTHCAKALEAAASLCLGRMTDEITVEHWLLKLIEAGDGDIPAILRHYAIDVDKVWDA
LIASIDRLPRNLRGKPAISLQLATVLQDAWLQASPDGEDTSIRSGNLLQAIVATPYVLRAQDAWPLLSIS
SAQIERLLPRLAHRSCESRVEPEAMADADADTPSASDEPHGQADEHATEAASVRSRSTDGEALARFAIDL
TDKARRGDIDPVFGRDREIQQMVDVLARRRKNNPILVGEPGVGKTALVEGLALRVANKDVPNVIRDVRIL
TLDLGLLQAGAGVKGEFEQRLKNVIDEVQASPEPILLFIDEAHTLIGAGNAAGGADAANLLKPALARGEL
RTIAATTWSEYKQFFERDAALERRFQIIKVDEPDDDAACLMLRGLKNHYAKYHHVHIRDEALVAAVKLSR
RYIPARQLPDKAVDLIDTAAARVRMGLETPPAELQRARAAVSALELEQTTLDADAQAGIDGIENRREVLA
RALSDARNALTLLQTRYTTELELVQLVHEQRAAKENAEAVAELGSLDDAQQLLADVQGKAPLVFVDVDAA
AIARVVAEWTGVPVGSLVEDELQSLLTLERQLATRVVAQDDALGALAESLRTAKAGLKNENAPLGVFLLA
GPSGVGKTETALALADLLFGGEAALTTINMSEYQEAHTVSQLKGSPPGYVGYGRGGVLTEAVRQRPYSVV
LLDEVEKAHRDVLDMFYQVFDRGTMRDGEGREIDFRNCVILMTSNLGSAQIDDATADDPHITQAALLDAI
HPQLVAHFQPALLARFQSLVYRPLDAAALSSIVRLKLAKVAERLRRQHDVELSCDDALIGSMAELCLARE
SGARNVDAFLNQRILPTVSRELLARMAAGDMPAKIVLSSSADGNLTIDFVARDAVAAGPSEPASAAA
 
Nucleotide Sequence: 2724 bp     [Download]
>gi|387905813|ref|NC_017922.1|:808770-811493 Burkholderia sp. KJ006 chromosome 3, complete sequence
ATGATCTCGCGCGATACCACTCACCTGCTCCGCCGGCTCAATACGCATTGCGCGAAGGCGCTCGAAGCGG
CAGCCAGTCTGTGCCTGGGGCGAATGACGGATGAAATCACCGTCGAGCACTGGCTGTTGAAACTGATCGA
GGCAGGTGATGGCGACATCCCGGCGATTCTTCGGCACTACGCGATCGACGTCGACAAGGTGTGGGACGCG
CTGATCGCGTCGATCGATCGGCTGCCGCGCAATCTGCGCGGCAAGCCGGCGATCTCGCTGCAACTGGCGA
CCGTCCTGCAGGACGCGTGGCTACAGGCGTCGCCCGACGGCGAAGATACGTCGATCCGGTCCGGCAACCT
GTTGCAGGCGATCGTCGCCACGCCATACGTTCTGCGCGCGCAAGACGCCTGGCCGCTGCTGTCGATCAGC
AGCGCGCAGATCGAGCGCCTGCTGCCGCGCCTCGCGCATCGATCCTGCGAAAGCCGCGTCGAACCCGAAG
CGATGGCCGACGCGGATGCCGACACGCCGTCTGCGAGCGACGAACCGCACGGCCAGGCCGACGAGCACGC
AACCGAAGCGGCATCGGTACGTAGCCGGTCCACCGACGGCGAAGCGCTCGCGCGCTTCGCGATCGATCTG
ACCGACAAGGCGCGTCGCGGCGACATCGATCCGGTCTTTGGCCGCGACCGCGAGATCCAGCAGATGGTCG
ACGTGCTCGCGCGTCGACGCAAGAACAACCCGATCCTCGTCGGTGAACCGGGCGTCGGCAAGACCGCGCT
CGTCGAAGGGCTCGCGCTGCGTGTCGCCAACAAGGACGTGCCGAACGTGATTCGCGACGTTCGGATCCTG
ACGCTCGATCTCGGCCTGCTGCAGGCCGGCGCCGGCGTGAAGGGCGAATTCGAGCAGCGCCTGAAGAACG
TGATCGACGAGGTGCAAGCGTCGCCGGAGCCGATTCTGCTGTTCATCGACGAAGCCCATACGTTGATCGG
CGCCGGCAACGCCGCCGGCGGCGCCGATGCGGCCAACCTGCTGAAGCCGGCCCTCGCGCGCGGCGAACTG
CGCACCATCGCCGCGACCACGTGGTCCGAATACAAGCAGTTCTTCGAGCGCGACGCCGCGCTCGAGCGAC
GCTTTCAGATCATCAAGGTCGACGAGCCCGACGACGATGCCGCCTGCCTGATGCTGCGCGGGCTGAAGAA
CCACTACGCGAAATACCATCACGTCCACATCCGCGACGAAGCGCTCGTGGCCGCGGTCAAGCTCTCGCGC
CGCTACATCCCCGCTCGGCAGCTGCCGGACAAGGCGGTCGACCTGATCGATACGGCGGCCGCGCGCGTGC
GCATGGGGCTCGAAACGCCGCCCGCCGAACTGCAGCGCGCACGCGCGGCGGTGTCGGCGCTCGAGCTGGA
GCAGACGACGCTCGACGCCGATGCGCAGGCCGGGATCGACGGCATCGAGAACCGGCGCGAAGTGCTGGCG
CGCGCGCTGAGCGACGCGCGCAATGCGCTCACGCTGTTGCAGACGCGCTATACCACCGAACTCGAACTGG
TTCAGCTGGTGCATGAGCAGCGCGCGGCGAAAGAAAACGCAGAGGCCGTCGCCGAACTCGGATCGCTCGA
CGACGCGCAGCAGCTCCTCGCCGATGTGCAGGGCAAAGCACCGCTAGTGTTCGTGGACGTCGATGCGGCG
GCCATTGCGCGCGTCGTCGCCGAATGGACCGGCGTGCCGGTCGGCAGCCTCGTGGAGGACGAGCTGCAGA
GCTTGCTGACGCTCGAACGGCAACTGGCCACGCGGGTCGTCGCGCAGGACGATGCTCTCGGCGCGCTCGC
CGAGAGCTTGCGGACCGCCAAGGCCGGCCTCAAGAACGAGAACGCGCCGCTCGGCGTCTTCCTGCTCGCC
GGCCCGTCGGGTGTCGGCAAGACCGAAACCGCGCTGGCGCTGGCCGACCTGCTGTTCGGCGGGGAGGCCG
CGCTCACGACGATCAACATGTCGGAGTATCAGGAAGCGCATACGGTGTCGCAGCTGAAGGGCTCGCCGCC
CGGCTACGTCGGCTACGGCCGCGGCGGCGTCCTGACCGAAGCCGTGCGGCAACGGCCGTACAGCGTCGTG
CTGCTCGACGAGGTCGAAAAGGCGCATCGCGACGTGCTCGACATGTTCTATCAGGTGTTCGACCGCGGCA
CGATGCGCGACGGCGAAGGACGCGAGATCGACTTCCGCAATTGCGTGATCCTGATGACGTCCAATCTCGG
CAGCGCGCAGATCGACGACGCCACCGCCGACGATCCGCACATCACGCAGGCGGCGCTGCTCGACGCGATT
CATCCGCAGCTCGTCGCGCACTTCCAGCCCGCGTTGCTCGCACGCTTCCAGTCGCTCGTCTACCGGCCGC
TCGATGCCGCCGCGCTGTCGTCGATCGTGCGGCTGAAGCTCGCGAAGGTGGCCGAGCGCCTGCGCCGGCA
ACACGACGTCGAACTGTCCTGCGACGACGCGCTGATCGGCTCGATGGCCGAGCTTTGTCTCGCTCGCGAA
TCCGGCGCGCGCAACGTCGACGCGTTCCTTAATCAACGCATTCTGCCGACCGTGTCGCGCGAGCTGCTCG
CGCGCATGGCCGCCGGCGACATGCCGGCGAAGATCGTCCTGTCGAGCTCGGCCGACGGCAACCTGACGAT
CGATTTCGTCGCCCGGGACGCCGTCGCGGCCGGCCCGAGCGAGCCGGCATCGGCCGCCGCGTGA
 Primer design