SecReT6
Protein ID: 387906503
SecReT6 ID661
T6SS typei2
Gene symbol-
Locus tagMYA_5772
StrainBurkholderia sp. KJ006
Repliconchromosome III [GenBank: NC_017922] [Browse all T6SS(s) in this replicon]
Location [Strand]811509..811934 [+]
Producthypothetical protein
NoteTssE
UniProt IDI2DZN3
KEGG IDbuk:MYA_5772
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 7.30E-18, Aligned region: 32..114
Protein Sequence: 141 a.a.     [Download]
>gi|387906503|ref|YP_006336840.1| hypothetical protein MYA_5772 [Burkholderia sp. KJ006]
MPAGPSLYDMLLGQISGEPLDAYDDRTLECMSVQQNVQRILNTRAGALKHLPDYGLPDLTNIYKALPASA
HVLKQQMEATLVKYEPRIRSVDVDILDNDDPGVLVCFEMTCHLKKAGLVRFGTYFEPPGRMWLKRRAADR
R
 
Nucleotide Sequence: 426 bp     [Download]
>gi|387905813|ref|NC_017922.1|:811509-811934 Burkholderia sp. KJ006 chromosome 3, complete sequence
ATGCCGGCCGGCCCTTCCCTCTACGACATGCTGCTCGGCCAGATCAGCGGCGAGCCGCTCGACGCCTACG
ACGACCGGACGCTCGAGTGCATGAGCGTCCAGCAGAACGTCCAGCGCATTCTGAACACGCGCGCCGGGGC
GCTGAAACACCTGCCCGATTACGGCCTGCCGGACCTGACGAACATCTACAAGGCGCTGCCCGCATCGGCT
CACGTGCTCAAGCAGCAGATGGAAGCGACGCTCGTGAAATACGAGCCGCGCATCCGTTCCGTCGACGTCG
ACATCCTCGACAACGACGATCCCGGCGTGCTCGTCTGTTTCGAGATGACGTGCCATCTGAAGAAAGCCGG
CCTGGTGCGGTTCGGCACCTACTTCGAGCCGCCCGGCCGCATGTGGCTGAAACGCCGGGCGGCTGACCGC
CGCTGA
 Primer design