SecReT6
Protein ID: 389841188
SecReT6 ID662
T6SS typei2
Gene symbolvasK
Locus tagES15_2188
StrainCronobacter sakazakii ES15
Repliconchromosome [GenBank: NC_017933] [Browse all T6SS(s) in this replicon]
Location [Strand]2329847..2333245 [-]
Producttype VI secretion system core protein VasK
NoteTssM
UniProt IDI2EJA9
KEGG IDcsk:ES15_2188
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 5.90E-72, Aligned region: 420..734
DUF1215 [PF06744], Evalue: 7.30E-34, Aligned region: 855..976
ImcF-related_N [PF14331], Evalue: 0.0032, Aligned region: 175..232
Protein Sequence: 1132 a.a.     [Download]
>gi|389841188|ref|YP_006343272.1| type VI secretion system core protein VasK [Cronobacter sakazakii ES15]
MFKVKKRSLIGSTVAALLCLEAIVVFLLYACPQWVATNMGIGPFDGPRILTVCSMLAATLLLIGWLIDKA
FGYSGKSGLYFEWGKNKSLKAQHEPEILPGPDDNTQAVFSETPVTEHLRLRYGRFWQRKVRLLLVIGEEN
EVEKAAPGLCRELWQEGDGNVLIYGGDGQSPQDEAFLNALKRLRPRCPLDGIVQVLNSQKLPTDIECDAF
ARCRHKAAQMLGWQVPVWLWLTDNARWLQETREALATGILFGPDAAPEDAMKTLNALTPRLRRAGIAQML
KNPRHDGLLYLASRLQGELKSHIHALLQGLMNGPSAYRLRGMMFSPALAGADHALIPHTRLNTSTWQAVV
DDCAEVRAKKIGFDGVKVLQRFLLVFAVFWSTGTLLSLGVNRTDIYLAQETARQAANGKLPLADRLKNQL
ALQQTMARLQHREATGAPWYTRFGLNQDRDMLSSLWPRYAQNNTFLMRDAAAAQLHQQLDAFIRLPPLSK
ARVEGTQRAYDLLKAYLMLAQPEKAEAVWLSRTLSSLWPTRQGVPDGLWQDLSPKLLAFYAQNLPTHPEW
KVKPDAELINTVRQILLKQIGQRNAETGLYQEMLKRVASNWPDLQLADMTGDTDASTLFTTDEVVPGMFT
RQAWEEQVQGAIDEVVKSRNDAIDWVLADKHHQPDADLSPEALKARLTARYFTDFGNAWLNMVNSIQWIE
ADSLSDSIAQLNLLADVRQSPLVALMNTLNYQGKTGQQREALADSLVESAKNLIGKKKNTKAILKQAQGP
EGPLDNVFGPLTGLMEGKDGAGASGNLSFQSWLSRVTQVRLKLQQITSAPDPQAMAQMLAQTVFEGKAID
LTDTRDYGSLVAASLGQEWSGFGQALFVQPLDLAWRPVLAPAASGLNERWKTTIVEQWNTAFAGRYPFKA
TGSDASMPILAQFLRADSGRIATFLKNNLGGILHQEGNRWVVDPSASQGMTVNPAFLAAINQLATIADTV
FEQGDAGVRFELMARPSRDVARMLLTLDGQKLDYFNQMESWRSFSWPGETWYPGVDLSWRTVSSGMQLYS
NNAGKWGFIRLLGKAQITPVDSSRIQLVWVAPDGSPLKFIMRTELGDGPLALLKLQGFTLPETIFSQQEI
VPTDDEPEQGVE
 
Nucleotide Sequence: 3399 bp     [Download]
>gi|389839000|ref|NC_017933.1|:c2333245-2329847 Cronobacter sakazakii ES15 chromosome, complete genome
ATGTTTAAGGTAAAAAAGAGATCGCTGATTGGCTCGACGGTGGCAGCGTTGCTTTGTCTTGAAGCGATAG
TCGTATTTTTGCTGTATGCCTGCCCGCAATGGGTGGCAACGAATATGGGAATTGGCCCTTTTGATGGACC
GCGGATCCTCACCGTTTGTTCAATGCTCGCCGCAACGTTACTTCTTATCGGCTGGCTTATTGATAAGGCA
TTTGGTTATTCCGGCAAATCGGGCCTCTATTTCGAGTGGGGCAAAAATAAGTCGCTGAAAGCACAGCACG
AGCCGGAAATTTTACCCGGCCCTGATGACAACACACAGGCCGTATTCAGCGAAACGCCTGTTACAGAACA
TCTTCGGCTGCGCTATGGCCGGTTCTGGCAGCGTAAGGTTCGCCTCTTGCTCGTTATTGGCGAGGAAAAT
GAAGTGGAAAAGGCGGCACCGGGCCTTTGCCGTGAACTGTGGCAAGAGGGCGATGGCAATGTGCTTATCT
ATGGTGGCGACGGGCAGTCGCCGCAGGATGAAGCATTTTTGAACGCACTGAAACGTCTGCGCCCACGTTG
CCCGCTGGATGGCATCGTTCAGGTGCTGAACAGCCAAAAACTTCCGACCGACATCGAATGTGATGCGTTT
GCCCGCTGTCGTCACAAGGCGGCACAGATGCTGGGCTGGCAGGTACCAGTTTGGTTATGGTTAACGGATA
ACGCGCGCTGGTTACAGGAGACACGTGAGGCTCTTGCCACGGGGATCCTGTTTGGCCCGGATGCCGCGCC
AGAAGACGCGATGAAAACACTGAATGCGCTGACGCCCCGTCTGCGTCGGGCAGGTATCGCGCAAATGCTT
AAAAACCCGCGCCATGATGGTCTCTTGTATCTGGCGTCCCGGTTACAGGGCGAGCTGAAATCGCATATCC
ACGCGTTGCTTCAGGGCTTAATGAACGGGCCTTCGGCGTACCGGTTACGCGGCATGATGTTCAGCCCTGC
ACTGGCAGGTGCAGACCACGCCCTGATTCCTCACACACGGCTGAATACCTCAACCTGGCAGGCTGTCGTT
GACGACTGCGCTGAGGTGCGCGCAAAAAAAATCGGCTTTGATGGGGTCAAGGTACTACAACGATTTCTGT
TAGTTTTCGCCGTGTTCTGGAGCACCGGCACGCTGCTTTCGCTCGGGGTCAACCGTACTGATATTTATCT
GGCGCAGGAGACGGCTCGCCAGGCGGCTAACGGCAAACTGCCGTTGGCAGACCGCCTGAAAAATCAGCTC
GCTCTGCAGCAGACAATGGCGCGCCTGCAGCACCGCGAGGCTACCGGTGCGCCCTGGTATACTCGTTTTG
GGCTGAATCAGGACCGTGACATGTTATCGTCGCTGTGGCCCCGCTATGCTCAGAATAATACCTTCCTGAT
GCGTGATGCCGCGGCCGCGCAACTCCACCAGCAGCTTGATGCGTTCATTCGTCTGCCGCCGCTCAGCAAG
GCAAGGGTTGAAGGAACGCAGAGGGCATATGATTTGCTAAAAGCGTATCTGATGCTCGCGCAACCGGAGA
AAGCGGAGGCAGTATGGCTTTCCAGAACGCTGTCGAGCCTCTGGCCGACGCGTCAGGGCGTGCCAGATGG
CCTTTGGCAGGATCTCTCGCCGAAGTTACTGGCATTCTATGCACAAAACCTTCCGACCCACCCGGAATGG
AAAGTCAAACCTGACGCTGAGCTCATCAACACCGTTCGCCAAATCCTGCTGAAACAAATTGGCCAGCGTA
ACGCCGAAACGGGTTTATATCAGGAAATGCTGAAACGCGTGGCCAGTAACTGGCCGGATCTACAGCTTGC
GGATATGACGGGTGACACCGATGCCTCCACACTTTTTACCACAGACGAAGTGGTGCCAGGCATGTTTACT
CGCCAGGCCTGGGAAGAACAGGTTCAGGGCGCAATTGATGAAGTGGTGAAATCCCGTAACGACGCCATTG
ACTGGGTATTGGCGGATAAACATCATCAGCCGGACGCTGACCTTTCTCCTGAAGCCCTGAAAGCCCGGTT
GACCGCGCGTTACTTCACTGATTTCGGTAATGCCTGGCTCAATATGGTCAACAGCATCCAGTGGATTGAA
GCTGACTCACTATCAGATTCAATTGCCCAGCTGAACCTGCTGGCCGATGTGCGCCAGTCTCCGCTGGTAG
CGCTAATGAACACCTTAAACTATCAGGGAAAAACCGGTCAGCAGCGTGAGGCGCTGGCGGATTCTCTGGT
GGAATCCGCAAAAAATCTGATAGGTAAAAAGAAAAACACCAAAGCCATTCTTAAACAGGCGCAGGGGCCG
GAAGGACCGCTGGATAACGTCTTCGGCCCGTTAACCGGGCTGATGGAAGGTAAGGACGGGGCGGGCGCGA
GCGGTAACCTCAGCTTTCAGTCCTGGCTTTCGCGCGTGACGCAGGTGCGCCTTAAGCTTCAGCAGATAAC
AAGCGCTCCGGACCCGCAGGCGATGGCGCAAATGCTGGCGCAGACGGTTTTCGAAGGTAAGGCCATCGAT
CTGACGGATACCCGAGATTACGGCAGCCTGGTGGCAGCGAGCCTCGGGCAGGAGTGGAGCGGTTTCGGCC
AGGCATTGTTTGTTCAGCCACTGGATCTGGCCTGGCGGCCGGTTCTTGCCCCGGCGGCCAGTGGGCTGAA
CGAGCGCTGGAAGACCACCATTGTTGAACAATGGAACACCGCATTTGCAGGACGTTATCCCTTTAAAGCC
ACCGGCAGCGATGCCTCAATGCCCATACTGGCGCAGTTTTTACGCGCTGACTCCGGGCGTATCGCCACGT
TTCTGAAAAATAATCTCGGCGGAATTTTGCATCAGGAAGGCAACCGCTGGGTAGTTGACCCTTCAGCCAG
CCAGGGAATGACGGTGAATCCGGCGTTTCTTGCGGCGATTAATCAACTGGCGACTATCGCAGATACGGTC
TTCGAGCAGGGTGATGCCGGGGTACGCTTTGAGCTGATGGCCCGTCCGTCTCGCGATGTTGCCCGAATGC
TGTTGACTCTGGATGGGCAAAAGCTCGATTACTTCAACCAAATGGAAAGCTGGCGAAGCTTTAGCTGGCC
TGGAGAGACATGGTATCCGGGCGTCGATCTCAGCTGGCGTACCGTCAGCAGCGGTATGCAGCTTTACAGT
AATAACGCCGGTAAATGGGGGTTCATTCGTCTGTTAGGCAAAGCGCAAATAACGCCAGTCGACAGCAGCC
GGATACAGCTCGTGTGGGTCGCGCCAGACGGCAGCCCGCTTAAATTTATTATGCGTACTGAACTGGGCGA
CGGCCCGCTTGCGTTACTGAAGCTGCAAGGATTTACGCTGCCTGAAACCATTTTCAGCCAGCAAGAAATA
GTGCCCACGGATGATGAGCCAGAACAAGGAGTTGAATAA
 Primer design