SecReT6
Protein ID: 389841811
SecReT6 ID663
T6SS typei3
Gene symbolicmF
Locus tagES15_2811
StrainCronobacter sakazakii ES15
Repliconchromosome [GenBank: NC_017933] [Browse all T6SS(s) in this replicon]
Location [Strand]3026434..3027783 [-]
ProductIcmF family protein
NoteTssM
UniProt IDI2EL32
KEGG IDcsk:ES15_2811
PDB IDNA
Domain hit(s) vs Pfam DUF1215 [PF06744], Evalue: 4.40E-28, Aligned region: 193..294
IcmF-related [PF06761], Evalue: 2.40E-13, Aligned region: 4..80
Protein Sequence: 449 a.a.     [Download]
>gi|389841811|ref|YP_006343895.1| IcmF family protein [Cronobacter sakazakii ES15]
MGNDKGGMINPMMLRNDVLARYLDEYAGYWERLLNGVALLPVDTAQTAGMAPNIFMLRTLVAANSPLVNL
VREAVKQTTLTAKGPDITETLNLTNRSALLSNAKRLNDRVAFQERRLLQERVDNRFAALREFYSGSALPD
AKTGMISAVPGSSFNRVIGLLNDQYTLFVMYDNALQTGDPPALSDAARRLAVESETWPAPLKNIIAPLLN
HSFQKVEGEVATQQQNAIDAGPGEACRRAIEGRYPLSDSNQEISLNQFERFFGAGGELDSWFQTHLAENV
DTASTPWRYKGRAQGEGLGVFEQGAEVRSALFQGEDGRKVALDLSVAVVYMDPSITRLQMQFDDAIADYS
HGPVRPLFFHWPGGHSANEIRLSARPAQRESTSELVVEGSWSLLHWVDNASDVRQTADGKTIVTYFFNKR
RVDFEVTGLNWAGRFIPDLLKDFACPAAA
 
Nucleotide Sequence: 1350 bp     [Download]
>gi|389839000|ref|NC_017933.1|:c3027783-3026434 Cronobacter sakazakii ES15 chromosome, complete genome
ATGGGTAATGACAAAGGCGGCATGATTAACCCGATGATGCTGCGAAACGACGTGCTGGCGCGCTATCTCG
ATGAATACGCTGGTTACTGGGAGCGTCTGCTGAACGGGGTCGCGCTTTTGCCTGTCGACACGGCGCAAAC
GGCGGGTATGGCTCCCAACATTTTTATGCTGCGCACGCTGGTGGCGGCTAACTCTCCGCTGGTGAATCTG
GTACGCGAAGCGGTAAAGCAAACCACACTGACGGCCAAAGGGCCGGACATCACCGAAACGCTTAATCTTA
CCAACCGCAGCGCGTTGTTGAGCAACGCGAAAAGGCTGAACGATCGGGTGGCTTTTCAGGAACGACGTTT
GCTTCAGGAACGGGTCGACAACCGTTTTGCGGCCCTGCGTGAATTTTACAGCGGCAGCGCGTTGCCGGAT
GCTAAAACAGGAATGATATCTGCCGTGCCCGGTTCGTCGTTTAACCGCGTTATTGGTCTGCTTAACGATC
AATACACGCTGTTTGTCATGTATGACAACGCCCTGCAAACCGGCGATCCGCCAGCGTTATCTGATGCCGC
CAGACGGCTCGCGGTGGAATCCGAGACCTGGCCTGCGCCGCTTAAAAATATTATCGCGCCGCTACTGAAT
CACTCCTTTCAGAAAGTCGAAGGTGAAGTGGCCACGCAGCAACAAAATGCGATCGACGCCGGGCCTGGTG
AGGCGTGTCGCCGCGCCATTGAGGGGCGCTACCCGCTAAGCGACAGCAACCAGGAAATCAGCCTCAATCA
GTTTGAGCGGTTTTTCGGCGCAGGCGGCGAGCTGGATAGCTGGTTCCAGACGCATCTTGCTGAGAACGTG
GATACCGCCTCCACCCCGTGGCGTTACAAAGGACGTGCGCAGGGGGAAGGGCTTGGCGTGTTTGAGCAAG
GTGCCGAGGTTCGCAGCGCCTTATTCCAGGGAGAAGACGGCAGAAAAGTCGCGCTCGATCTCTCGGTGGC
GGTGGTTTACATGGACCCGTCGATTACCCGGCTACAGATGCAGTTTGACGACGCGATTGCTGACTATTCT
CACGGTCCGGTGAGGCCGCTGTTTTTCCACTGGCCGGGCGGGCATTCGGCAAACGAGATCCGACTCTCCG
CACGTCCCGCGCAGAGAGAATCCACCTCTGAACTGGTGGTGGAAGGTTCATGGTCGCTGCTGCACTGGGT
GGATAACGCCAGCGACGTGCGCCAGACGGCCGACGGGAAAACGATCGTGACGTACTTTTTTAATAAACGC
CGCGTCGATTTTGAAGTGACAGGATTGAACTGGGCCGGGCGATTTATCCCCGATTTGCTGAAAGACTTTG
CCTGCCCGGCGGCGGCATAA
 Primer design