SecReT6
Protein ID: 389841812
SecReT6 ID663
T6SS typei3
Gene symbol-
Locus tagES15_2812
StrainCronobacter sakazakii ES15
Repliconchromosome [GenBank: NC_017933] [Browse all T6SS(s) in this replicon]
Location [Strand]3027813..3028472 [-]
Producthypothetical protein
NoteTssM
UniProt IDI2EL33
KEGG IDcsk:ES15_2812
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 6.90E-53, Aligned region: 2..215
Protein Sequence: 219 a.a.     [Download]
>gi|389841812|ref|YP_006343896.1| hypothetical protein ES15_2812 [Cronobacter sakazakii ES15]
MKTTRELAAFPGLSPDAPGHDWRYGLYTGDAVSQQADTLYHYFLQRLLFPLIERDATQALKKALQEGNQA
DLFDALKRYLMLTGEERFDLAYLVDSITRLWSESGKITAFEEKAVFTDHLNALFSQPEWRRFGEPRDESL
VREARKRLAQTTLTTRLWSRVRDQLETDAPQDLTLNQLAGESSAHIFTLEDTALLASGIPGLYTVEGYHQ
LVKKNCRCC
 
Nucleotide Sequence: 660 bp     [Download]
>gi|389839000|ref|NC_017933.1|:c3028472-3027813 Cronobacter sakazakii ES15 chromosome, complete genome
TTGAAAACAACCCGGGAGCTGGCGGCGTTTCCGGGGCTGTCCCCCGACGCTCCCGGTCACGACTGGCGCT
ACGGGCTGTATACCGGTGATGCTGTCTCGCAACAGGCCGATACGCTGTATCACTACTTCCTGCAGCGTCT
GCTGTTTCCGCTGATTGAGCGTGACGCGACGCAGGCACTGAAAAAGGCGCTGCAGGAGGGAAATCAGGCC
GACCTTTTCGACGCGCTGAAGCGTTATCTGATGCTGACCGGGGAGGAGCGTTTCGATCTTGCGTATCTCG
TTGACAGCATTACGCGGCTCTGGAGCGAGAGCGGAAAAATCACCGCTTTTGAAGAGAAAGCGGTCTTTAC
CGACCACCTGAATGCATTGTTCTCGCAGCCGGAATGGCGGCGCTTCGGCGAGCCGCGCGATGAGAGTCTC
GTCAGAGAAGCGCGAAAACGTCTTGCGCAAACCACGCTGACCACGCGGCTCTGGAGCCGCGTGCGTGACC
AGCTTGAAACCGACGCGCCGCAGGATCTCACGCTCAATCAGCTGGCGGGCGAATCGTCGGCCCATATTTT
CACACTGGAAGATACAGCGCTGCTGGCGAGCGGCATTCCTGGGCTATACACCGTTGAGGGATATCACCAG
CTCGTTAAAAAAAACTGCCGCTGCTGCTGA
 Primer design