SecReT6
Protein ID: 389841813
SecReT6 ID663
T6SS typei3
Gene symbolimcF
Locus tagES15_2813
StrainCronobacter sakazakii ES15
Repliconchromosome [GenBank: NC_017933] [Browse all T6SS(s) in this replicon]
Location [Strand]3028469..3030208 [-]
ProductImcF family protein
NoteTssM
UniProt IDI2EL34
KEGG IDcsk:ES15_2813
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 1.60E-66, Aligned region: 249..533
AAA_16 [PF13191], Evalue: 0.0097, Aligned region: 182..310
Protein Sequence: 579 a.a.     [Download]
>gi|389841813|ref|YP_006343897.1| ImcF family protein [Cronobacter sakazakii ES15]
MAFLNRLFSGRSLKFLLMAAWFVLMACAIGYLGPYIGFGEARPFAPAGARLLFILLALLWLVAIWYGVAL
CLPGALTLCAAVWVAGPYVLIGEHYPLHSAAVRLAIIAVVMTLILLYAAWRLLLFTLNNPAWTEKIRFRR
TASVPDPAISEVTRIIRDAQAFSRRIYRQETGWRRFFVGRHVSDAQPCYLVLGPQSAGKTSLVLASGQEF
PLPEQLNRTGKENPPTANCECFFANDALFIDTSGKYVSQGNESRQEWQALLQAIRKYRPATGINGALLAF
SAREILGLPTTQQLAFAATLRARLDELRTTLGACFPVYLIVTKVDELTGFDAWFRHLTAQEREQIWGVTF
PWGDISRRPTPESDIEDELLLLENRLSSAVTLRHQEEYAVADRKKMYAVPQDFRLLAQRLSALLRPIFFA
SRYDETQFNSTLRGVYFTSCCQPESVTLRNSATLVQQWRHATDQAPVESGGCLPEATPEDERPGAEMVWG
KRYFLQRLFADIIIKDAGLVRYNLRAQTTWRFRNLAGHLAGIALSLFLIKGLFTSYAHNRDYLQAVGHHA
NELQHEVHAFIKTHDLPRY
 
Nucleotide Sequence: 1740 bp     [Download]
>gi|389839000|ref|NC_017933.1|:c3030208-3028469 Cronobacter sakazakii ES15 chromosome, complete genome
ATGGCTTTTTTGAATCGGTTATTTTCCGGACGGTCTTTAAAATTTCTCCTGATGGCGGCCTGGTTTGTGC
TTATGGCGTGCGCTATCGGGTATCTCGGGCCGTATATCGGTTTTGGCGAGGCGCGGCCTTTTGCCCCGGC
GGGCGCGCGTCTCCTGTTTATCCTGCTTGCGCTCCTGTGGCTTGTGGCCATCTGGTATGGCGTCGCGCTG
TGTCTGCCTGGCGCGTTAACCCTCTGCGCCGCGGTCTGGGTCGCCGGGCCGTATGTGCTGATTGGGGAGC
ATTATCCGTTACACAGCGCCGCAGTCCGGCTCGCGATTATTGCCGTCGTGATGACGCTGATCCTTCTCTA
TGCGGCCTGGCGGCTGTTGCTGTTCACGCTCAACAATCCTGCATGGACTGAAAAAATACGCTTTCGCCGC
ACTGCCAGCGTGCCGGATCCTGCAATATCCGAGGTGACGCGCATCATTCGCGATGCGCAGGCATTCAGCC
GCCGCATTTATCGGCAGGAAACGGGCTGGCGTCGCTTTTTTGTGGGGCGTCATGTCAGTGACGCGCAGCC
CTGTTATCTCGTCCTTGGCCCGCAAAGCGCGGGTAAAACCTCACTGGTGCTCGCCTCGGGGCAGGAGTTT
CCGCTCCCCGAACAGCTAAATCGTACCGGTAAAGAAAACCCGCCGACGGCTAATTGCGAATGCTTTTTCG
CTAATGACGCGCTTTTTATTGATACGTCGGGAAAATATGTAAGCCAGGGGAACGAGAGTCGCCAGGAGTG
GCAGGCGCTGCTACAGGCTATCCGCAAGTATCGCCCTGCGACGGGCATTAACGGCGCGCTGCTGGCGTTT
TCCGCGCGAGAAATTCTCGGGCTTCCGACAACGCAACAGCTGGCGTTTGCCGCCACGCTGCGCGCGCGTC
TGGACGAGCTTCGCACCACGCTCGGAGCCTGCTTCCCGGTTTATCTCATCGTGACGAAAGTCGATGAGCT
GACCGGTTTTGACGCCTGGTTTCGCCATCTGACCGCCCAGGAGCGTGAGCAAATCTGGGGCGTGACCTTC
CCCTGGGGAGACATCAGCCGCCGCCCGACGCCAGAAAGTGATATTGAAGATGAGCTGCTGCTGCTGGAAA
ACCGCCTGAGCAGTGCCGTCACGCTTCGTCATCAGGAAGAGTACGCCGTGGCGGACAGGAAGAAAATGTA
TGCCGTTCCGCAGGATTTTCGGCTGCTCGCACAGCGTCTCTCTGCACTCCTGCGCCCTATATTCTTTGCT
TCACGTTATGACGAAACGCAGTTTAACAGCACGCTTCGCGGCGTGTACTTCACCAGTTGTTGTCAGCCGG
AGAGCGTGACGCTTCGCAACAGCGCTACGCTTGTGCAACAGTGGCGGCACGCGACAGATCAGGCACCGGT
TGAAAGCGGGGGCTGCCTGCCGGAAGCGACCCCAGAAGACGAGCGTCCAGGCGCAGAGATGGTCTGGGGC
AAACGCTATTTTTTACAGCGGCTTTTCGCCGATATCATTATCAAAGACGCGGGGCTTGTGCGTTATAACC
TGCGCGCGCAGACAACCTGGCGCTTTCGCAATCTCGCCGGCCACCTCGCCGGTATAGCGCTGTCGCTTTT
TCTCATCAAAGGCCTCTTCACCAGCTATGCGCACAACCGCGACTATCTGCAGGCTGTCGGCCATCACGCG
AATGAGCTACAGCACGAAGTACATGCGTTTATTAAAACGCATGACCTTCCGCGCTATTGA
 Primer design