SecReT6
Protein ID: 389842849
SecReT6 ID664
T6SS typei3
Gene symbolimpL
Locus tagES15_3849
StrainCronobacter sakazakii ES15
Repliconchromosome [GenBank: NC_017933] [Browse all T6SS(s) in this replicon]
Location [Strand]4198986..4202606 [-]
Producttype VI secretion system protein ImpL
NoteTssM
UniProt IDI2EP20
KEGG IDcsk:ES15_3849
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 1.30E-101, Aligned region: 207..484
ImcF-related_N [PF14331], Evalue: 1.30E-101, Aligned region: 764..815
IcmF-related [PF06761], Evalue: 3.70E-87, Aligned region: 533..836
DUF1215 [PF06744], Evalue: 6.60E-32, Aligned region: 947..1072
AAA_16 [PF13191], Evalue: 0.00071, Aligned region: 142..271
AAA_16 [PF13191], Evalue: 0.00071, Aligned region: 839..884
Protein Sequence: 1206 a.a.     [Download]
>gi|389842849|ref|YP_006344933.1| type VI secretion system protein ImpL [Cronobacter sakazakii ES15]
MLNILLSIVTNRILWGFMGVTALSAVVWMIGPLLSIVDSRPLESETNRIISIALIYLIWVHSHIVPRLYN
AWLNRKLMDKLNEGKPAEEGGSDVKRLGNDDKVLADRFDEAAQILKKAHFNAPGQRGQWTQRFSTQYLYQ
LPWYVIIGAPGSGKTTALVNSGLQFPLADRFGKTALRGIGGTRNCDWWFTNEAVLLDTAGRYTTQESEQA
QDAGEWLSFVDLLRKYRRRQPINGVIITISVSDLLTQSPEATQQQAVNLRQRLAELHEQLGIRFPVYVLV
TKADLLKGFRSYFGRFDKAQRDQIWGFTFPWDRSKQADFDLLGAFTQEFALLQQRLDAGLPDTLLAESDP
KARAECYLFPQEFAALRPLLADYLSTVFARSNFETEFSPRGIYLASGTQEGLPFDRVMGELNRALSLPSG
GKEGDNWDSVSKEAPIPGGKGQSFFIKNLLQNVIFQEAGIAGQNRWWELRNRAVLWSGYAALIALLVVLG
GLWLTSYGNNKDYLAEVNDKVPGVERQSKALQTTAGRDLFSMLPFFNSLVDLPKSKEFDLNSPPVTYRMG
LYRGDDVNDASQALYQKALQEMLMPAVAQLITGWVRNDNGSDVEYSYEALKAYQMLYQPKHYDGKFLHSW
VMLNLERNLPQNVTQAQLNQLEWHLTQLLEPQIQTSPYAKDESLISRQQAMINQKPLSLRVYGRLKRLLE
RDENLKLVSLATLGGPQSELVFSRKSGKPVSDGVPGLYTPKGYWESFNGQIDNVTASLHDDDTWVLGLTT
AQEDKTQTDNAVRQLYMRDFISQWDSYLADIQLNNSADLNQRINTARVLSSSNSPLRRLVMNLSQVLTLS
RAEPQAGEGEAKEQGNRATRTLEALFSDRESGATTAAAAPQTPEQVVTDHYAPIIELAQPLEKGGKTIVF
DDFIKQIDELYRYLTAVQDAANSGMPPPGGEAISRLQASAGRLPGGLQNMFSRMAVGASSDTQQRELENV
RKRISVEVGSFCRQAIAGRYPLVRSASSEVTPDDLARMFAPGTGLMDSFFRDNLTNKVDTTQQRWRFTPG
IDGKTLPGSEGVLRPFQQAQYIRDAFFANGATTPSYRVTVRTVRMDNDILTLSLDVDGQLLRYSHGPQAV
QLMSWPGSGGTNQVRMQLGLANGTTSTLVTNGAWALNRFFDRARIAPGAGSLSRQATFSVDGHSVTLEFT
PNSIRNPFQLPGFACP
 
Nucleotide Sequence: 3621 bp     [Download]
>gi|389839000|ref|NC_017933.1|:c4202606-4198986 Cronobacter sakazakii ES15 chromosome, complete genome
ATGCTGAATATTCTCCTTTCAATAGTGACCAACCGCATCTTGTGGGGGTTCATGGGCGTTACCGCGCTGT
CGGCGGTCGTCTGGATGATCGGGCCATTGCTGTCCATCGTCGACAGCCGCCCGCTGGAGTCGGAAACCAA
CCGTATCATCAGCATTGCGCTTATCTACCTGATTTGGGTGCATAGCCACATCGTGCCGCGGCTCTACAAC
GCCTGGCTGAACCGCAAGCTGATGGACAAACTCAACGAAGGCAAGCCTGCGGAAGAGGGCGGGAGCGACG
TTAAGCGCCTCGGCAATGACGATAAAGTGCTGGCGGACCGCTTTGACGAAGCCGCGCAGATCCTTAAAAA
AGCGCACTTCAACGCGCCGGGCCAGCGCGGCCAGTGGACGCAGCGTTTTAGTACGCAGTATCTCTATCAG
CTTCCGTGGTATGTGATTATCGGCGCGCCGGGTTCCGGTAAAACGACGGCGCTGGTCAACTCCGGCCTGC
AATTCCCGCTCGCCGATCGCTTTGGCAAAACGGCGCTGCGCGGCATTGGCGGCACCCGCAACTGCGACTG
GTGGTTCACCAACGAAGCGGTGCTGCTCGATACCGCAGGCCGTTACACCACGCAGGAGAGCGAACAGGCG
CAGGACGCCGGTGAATGGCTAAGCTTTGTCGATCTGCTGCGTAAATACCGCCGCCGCCAGCCGATTAACG
GCGTCATTATCACCATCAGCGTTTCTGATCTGCTGACCCAGTCGCCGGAAGCGACGCAACAGCAGGCCGT
CAACCTGCGCCAGCGTCTGGCGGAGCTGCATGAGCAACTCGGTATCCGCTTCCCGGTCTATGTGCTGGTG
ACCAAAGCGGACCTGCTGAAAGGCTTTCGTTCTTACTTTGGTCGCTTTGATAAAGCGCAGCGCGACCAGA
TCTGGGGCTTCACCTTCCCGTGGGATCGCTCAAAACAGGCCGATTTTGACCTCCTGGGCGCGTTCACCCA
GGAGTTCGCGCTGCTCCAGCAGCGTCTCGACGCGGGCCTGCCGGATACGCTGCTTGCCGAAAGCGACCCG
AAAGCGCGCGCCGAGTGTTATCTGTTCCCGCAGGAGTTCGCGGCGCTGCGTCCGCTGCTCGCGGATTACC
TCAGCACCGTTTTTGCCCGTTCTAACTTTGAAACCGAATTCTCGCCGCGCGGGATTTATCTTGCGAGCGG
GACGCAGGAAGGGCTGCCGTTTGACCGCGTGATGGGCGAACTCAACCGCGCGCTGTCGCTGCCGTCCGGC
GGCAAAGAGGGCGACAACTGGGATTCGGTGAGCAAAGAAGCGCCGATCCCCGGCGGTAAAGGGCAAAGCT
TCTTTATTAAAAACCTGCTGCAAAACGTGATTTTCCAGGAAGCGGGCATCGCCGGGCAGAACCGCTGGTG
GGAGCTGCGCAACCGCGCGGTGCTGTGGTCTGGCTATGCGGCGCTGATAGCGCTCTTAGTGGTGCTGGGC
GGTCTGTGGCTCACCAGCTATGGCAACAACAAAGACTATCTGGCGGAAGTGAACGATAAAGTGCCGGGCG
TCGAGCGCCAGAGTAAAGCGCTGCAAACCACCGCCGGGCGCGATCTCTTCAGCATGCTGCCGTTCTTTAA
CAGCCTGGTGGATCTGCCAAAGAGTAAAGAATTTGACCTGAACTCGCCGCCGGTGACGTACCGCATGGGG
CTTTATCGCGGCGATGACGTCAACGACGCTTCGCAGGCGCTCTACCAGAAAGCGCTGCAGGAAATGCTGA
TGCCTGCCGTGGCGCAGCTCATCACCGGCTGGGTGCGTAACGACAACGGCAGCGACGTGGAATACAGCTA
CGAAGCGCTGAAGGCGTACCAGATGCTCTACCAGCCGAAGCACTACGACGGCAAATTCCTGCACTCTTGG
GTGATGCTCAACCTTGAGCGCAACCTGCCGCAGAACGTCACCCAGGCACAGCTTAACCAGCTCGAATGGC
ATCTGACGCAACTGCTGGAGCCGCAGATCCAGACCTCGCCGTACGCCAAAGATGAGTCGCTGATCAGCCG
CCAGCAGGCGATGATCAACCAGAAACCGCTGTCGCTGCGCGTCTATGGCCGCCTCAAGCGGTTGCTGGAG
CGCGATGAAAACTTAAAGCTGGTGTCGCTCGCCACCCTCGGCGGGCCGCAGAGCGAACTGGTGTTTTCGC
GTAAAAGCGGCAAACCGGTGAGCGACGGCGTGCCGGGGCTCTACACCCCGAAAGGCTACTGGGAAAGTTT
CAACGGCCAGATTGATAACGTCACCGCCTCGCTGCATGACGACGACACCTGGGTGCTGGGCCTGACCACC
GCGCAGGAAGATAAAACGCAGACGGACAACGCGGTGCGTCAGCTCTATATGCGCGACTTTATCAGCCAGT
GGGACAGCTACCTGGCGGATATTCAGCTTAACAACAGCGCCGATCTGAACCAGCGCATTAACACGGCCCG
CGTGCTTTCCAGCAGCAACTCGCCGCTGCGCCGCCTGGTGATGAACTTAAGCCAGGTGCTGACGCTCTCC
CGCGCCGAGCCGCAGGCGGGCGAAGGGGAAGCGAAAGAGCAGGGCAACCGCGCGACCCGCACGCTGGAGG
CACTCTTCAGCGACCGCGAAAGTGGGGCGACTACCGCCGCCGCCGCGCCGCAAACGCCGGAACAAGTGGT
GACCGATCACTACGCGCCCATCATCGAACTGGCGCAGCCGCTGGAGAAAGGCGGCAAAACCATCGTGTTT
GATGACTTTATCAAGCAGATCGATGAGCTCTACCGCTACCTGACCGCCGTACAGGACGCCGCCAACAGCG
GTATGCCACCGCCGGGCGGCGAAGCGATCAGCCGTTTACAGGCGAGCGCCGGGCGTCTGCCGGGCGGGCT
GCAAAATATGTTCAGCCGCATGGCGGTAGGGGCGAGCAGCGACACCCAGCAGCGCGAACTGGAAAACGTC
CGCAAGCGTATCAGCGTGGAAGTCGGCAGCTTCTGCCGCCAGGCGATTGCCGGCCGGTACCCGCTGGTGC
GCTCCGCCAGCAGCGAAGTGACGCCGGACGATTTGGCGCGTATGTTCGCGCCGGGCACCGGCCTGATGGA
CAGCTTCTTTCGCGATAACCTGACGAATAAAGTCGATACCACCCAGCAGCGCTGGCGCTTTACGCCAGGC
ATCGACGGCAAAACGCTGCCGGGCAGCGAAGGGGTGCTGCGTCCGTTCCAGCAGGCGCAATACATTCGCG
ACGCGTTCTTCGCCAACGGCGCGACCACGCCGTCTTATCGCGTGACGGTGCGCACCGTGCGGATGGATAA
CGACATTCTGACGCTGTCGCTCGACGTTGACGGCCAGCTTCTGCGTTACAGCCACGGCCCGCAGGCGGTG
CAGCTGATGAGCTGGCCGGGCAGCGGCGGCACGAATCAGGTGCGTATGCAGCTCGGGCTTGCCAACGGCA
CCACCTCGACGCTCGTGACCAACGGCGCGTGGGCGCTGAACCGCTTTTTCGATCGCGCCCGCATTGCGCC
GGGTGCAGGAAGCCTGAGCCGCCAGGCGACGTTTTCGGTTGACGGACACAGCGTGACGCTGGAATTCACG
CCGAACAGTATCCGCAACCCATTCCAGCTCCCTGGCTTCGCATGCCCTTAA
 Primer design