SecReT6
Protein ID: 389875329
SecReT6 ID665
T6SS typei5
Gene symbol-
Locus tagTMO_a0077
StrainTistrella mobilis KA081020-065
Repliconplasmid pTM1 [GenBank: NC_017957] [Browse all T6SS(s) in this replicon]
Location [Strand]78000..81725 [-]
Producthypothetical protein
NoteTssM
UniProt IDI3TRU2
KEGG IDtmo:TMO_a0077
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 6.30E-94, Aligned region: 207..480
IcmF-related [PF06761], Evalue: 1.20E-88, Aligned region: 532..837
DUF1215 [PF06744], Evalue: 1.70E-33, Aligned region: 982..1102
AAA_33 [PF13671], Evalue: 0.0071, Aligned region: 126..229
Protein Sequence: 1241 a.a.     [Download]
>gi|389875329|ref|YP_006373064.1| hypothetical protein TMO_a0077 [Tistrella mobilis KA081020-065]
MSRVIEVLASKWFLSFLGIALLGVLVWVGGPLVAIGDSRPFEPVLTRALIAGGLFLIWAVAFVWSVIAAR
RRNAAMIEAIAAPEGPTPEDEEVDRLRERMVQALETLKRSRLGRGRQWLYQLPWYLMIGPPGAGKTTALI
NSGLDFPLAEDQAERRMRGIGGTRDCDWWFTDQAVLIDTAGRYTTQDSDGGVSSDGTAAGPGTRAGGRDR
AGWQGFLELLKKHRPRQPVNGVLVCISLAEVALASAAERDAHARALRRRLRELTEQLDVRVPVYVLVTKA
DLLAGFTAFFDDLDAAGRAQVWGMTFPFDDEVESEGESKGESGSRSAGAVAHFDAEFDRLIDRLNARVID
RMHAEPDGERRALIHGFPAQMASVRAPLGDFLRQVFQPTRLAERPLLRGVYLTSGTQEGTPFDRLTGAMA
RSFGLDRATQPPMTGRGRAFFLADLLNRVVFAEAGVVTTDPAAARRRRLIRHAGFATAAVVAIACVAAWT
VSYFGNSRLIDEAAAGIEEYRGAVTPFAETAVADDDLAELSPVLDRLRDVPTGAAETEAGLETPIDRGFG
LDQAPTLSQGTVSAYHRALNRLFLPRLLVRLENQLRAAASPSDVSYTALKVYLMLGAQGPIEPEVIGAWM
ALDWQNRWPGEENAPLRAALQDHLAALLDRPIASVPLDGALVEQVRTLLASQPLAERVYARLVESPAATA
LPAWTPVDHAGPQAARVLVRRSGKRLSEGIPGIYTYDGFHNTFLPALEAEVRATAEEGWVLSEKTRALTD
EEVAKLARDTLQLYYDDYVGIWNGLIADIDLAAFQSDTHAVESLNVLSSPRSPMVTLLKAVADETRLATP
RGDATAGGGDTGQAGNGRPSGSERAGDAVALEAESRMQRQFGFSGRIASLLLRDAASDALAGGNGGGGKE
LPGAYVEERFKELDGFVTAGPGGQAPVDAIVDDLGQLYRAMSRGRMAVDGPGGGAAAEAELAGLAQQLSL
DAGRAPDVMRGWAETIAERASSRTIGDTRARLNEAWALDGRDLCRTALAGRYPFDRGSRQDVKLDDFARI
FAGGGILDGFFRKELAPYVETGGRRWSWRKINNADLGIPNAVLADFREAARIRDAFFPGGGTVPDIGFDL
VPVSLTPSAARVVVEVNGQTAAYDHGPVRPMPLRWPGNGPQQVRVTFIGTDGTPAGGTSLTGPWALFRLI
DRSEVRQIASDRFEVTFRAGQNAARFEVRAGSVLNPFSLDDLRSFSCPRRF
 
Nucleotide Sequence: 3726 bp     [Download]
>gi|442559580|ref|NC_017957.2|:c81725-78000 Tistrella mobilis KA081020-065 plasmid pTM1, complete sequence
ATGTCGCGCGTGATCGAGGTGCTGGCCTCGAAATGGTTCCTGAGCTTCCTGGGCATCGCCCTGCTGGGGG
TGCTGGTCTGGGTGGGCGGGCCGCTGGTCGCGATCGGCGACAGCCGGCCGTTCGAACCGGTGCTGACCCG
GGCGCTGATCGCGGGCGGGCTGTTTCTGATCTGGGCGGTGGCTTTCGTGTGGAGCGTGATCGCCGCCCGC
CGCCGCAATGCCGCGATGATCGAGGCGATCGCCGCCCCCGAAGGCCCGACGCCCGAGGATGAGGAAGTCG
ACCGGCTGCGCGAGCGCATGGTTCAGGCGCTGGAAACGCTGAAGCGCTCGCGGCTGGGCCGTGGCCGGCA
ATGGCTGTACCAGCTGCCCTGGTATCTGATGATCGGCCCGCCCGGCGCCGGCAAGACCACCGCGCTGATC
AATTCGGGGCTGGATTTCCCCCTGGCGGAGGATCAGGCCGAGCGCCGGATGCGCGGCATCGGCGGTACCC
GCGACTGCGACTGGTGGTTCACCGACCAGGCGGTGCTGATCGACACCGCCGGCCGCTATACCACGCAGGA
CAGCGATGGCGGCGTGTCGTCCGATGGGACGGCTGCGGGACCCGGGACGCGGGCAGGCGGGCGTGACCGT
GCCGGCTGGCAGGGCTTTCTGGAGCTGCTGAAGAAGCACCGCCCGCGCCAGCCGGTGAACGGCGTGCTGG
TCTGCATTTCGCTGGCCGAGGTGGCGCTGGCCTCTGCCGCCGAACGCGATGCCCATGCCCGCGCACTGCG
CCGCCGGCTGCGCGAGCTGACCGAACAGCTGGATGTGCGGGTGCCGGTTTATGTGCTGGTCACCAAGGCC
GATCTTCTGGCCGGGTTCACCGCGTTTTTCGACGATCTGGACGCGGCCGGCCGCGCCCAGGTCTGGGGCA
TGACCTTCCCCTTCGACGACGAGGTCGAGAGCGAGGGGGAGAGCAAGGGTGAGAGCGGCAGCCGAAGCGC
TGGGGCCGTCGCGCATTTCGATGCCGAATTCGACCGGCTGATCGACCGGCTGAACGCCCGGGTCATCGAC
CGGATGCATGCCGAGCCCGATGGTGAGCGCCGGGCGCTGATCCATGGCTTCCCGGCGCAGATGGCCTCGG
TCCGGGCCCCCCTGGGCGACTTTCTGCGCCAGGTGTTCCAGCCGACCCGGCTGGCCGAGCGGCCGCTGCT
GCGCGGCGTGTATCTGACCAGCGGCACCCAGGAGGGCACGCCCTTCGACCGGCTGACCGGCGCCATGGCC
CGGTCCTTCGGTCTGGATCGTGCCACCCAGCCGCCGATGACCGGCCGCGGCCGCGCCTTCTTCCTGGCGG
ATCTGCTGAACCGGGTGGTGTTCGCCGAAGCCGGCGTGGTCACAACCGACCCCGCCGCCGCCCGGCGCCG
GCGGCTGATCCGCCATGCCGGTTTTGCGACCGCCGCCGTGGTCGCCATCGCCTGCGTTGCCGCCTGGACG
GTCTCGTACTTCGGCAACAGCCGGCTGATCGACGAGGCCGCGGCCGGCATCGAGGAGTATCGCGGGGCGG
TGACGCCTTTTGCCGAAACGGCGGTGGCCGATGACGATCTGGCGGAACTTTCGCCCGTTCTGGACCGGTT
GCGCGACGTACCGACCGGTGCGGCGGAAACCGAGGCCGGGCTTGAGACCCCGATCGATCGCGGCTTCGGG
CTGGACCAGGCGCCGACCCTGTCGCAGGGCACGGTGTCGGCCTATCACCGGGCCCTGAACCGCTTGTTCC
TGCCGCGACTGCTTGTGCGCCTGGAGAACCAGCTGCGGGCGGCGGCCTCGCCGTCGGATGTGTCTTACAC
CGCGCTCAAGGTCTATCTGATGCTGGGCGCGCAGGGGCCGATCGAGCCCGAAGTGATCGGCGCCTGGATG
GCGCTGGACTGGCAGAACCGCTGGCCGGGCGAAGAGAATGCGCCGCTGCGTGCAGCACTTCAGGACCATC
TGGCGGCGCTGCTCGACCGGCCGATCGCCTCGGTGCCGCTGGATGGTGCGCTGGTCGAACAGGTGCGCAC
GCTGCTGGCCTCTCAACCTTTGGCCGAACGGGTCTATGCCCGGCTGGTCGAGAGCCCGGCCGCAACCGCC
CTGCCGGCCTGGACGCCGGTCGACCATGCCGGGCCGCAGGCGGCGCGGGTGCTGGTCCGCCGATCGGGCA
AGCGGCTGTCGGAAGGCATTCCCGGCATCTATACCTATGACGGCTTCCACAACACCTTCCTGCCGGCGCT
GGAAGCGGAGGTGCGCGCCACCGCCGAAGAGGGCTGGGTGCTGAGCGAGAAGACCCGCGCACTGACCGAC
GAAGAGGTGGCGAAACTCGCCCGTGACACCCTGCAGCTCTATTACGACGACTATGTCGGGATCTGGAACG
GGCTGATCGCCGATATCGATCTGGCCGCCTTCCAGAGCGACACCCATGCGGTGGAAAGCCTGAACGTGCT
GTCCTCGCCGCGCTCGCCGATGGTGACCCTGCTGAAGGCGGTGGCCGACGAAACCCGGCTGGCGACCCCG
CGCGGGGATGCCACAGCCGGAGGCGGCGATACCGGGCAGGCGGGCAATGGCCGGCCGTCCGGCAGCGAGC
GTGCGGGCGATGCGGTGGCGCTTGAGGCCGAGAGCCGGATGCAGCGCCAGTTCGGCTTCAGCGGCCGGAT
CGCCAGCCTGCTGCTGCGCGATGCGGCATCGGATGCGCTGGCGGGCGGCAATGGCGGCGGCGGCAAGGAG
CTGCCCGGCGCCTATGTCGAAGAGCGGTTCAAGGAGCTGGACGGCTTCGTGACCGCCGGCCCCGGCGGTC
AGGCGCCGGTGGATGCGATCGTCGACGATCTGGGCCAGCTTTACCGGGCGATGAGCCGCGGCCGCATGGC
GGTGGACGGCCCCGGCGGCGGGGCTGCGGCCGAGGCGGAACTGGCCGGGCTGGCGCAGCAGCTGTCGCTG
GATGCCGGGCGCGCGCCCGATGTGATGCGCGGCTGGGCCGAGACCATCGCCGAGCGCGCCTCCAGCCGCA
CCATCGGCGACACGCGGGCCCGGCTGAACGAGGCCTGGGCGCTGGACGGCCGCGATCTCTGCCGCACGGC
GCTCGCCGGCCGCTATCCCTTCGATCGCGGCAGCCGCCAGGATGTGAAGCTGGACGATTTTGCCCGGATC
TTCGCCGGCGGCGGCATTCTGGACGGCTTTTTCCGCAAGGAGCTGGCGCCCTATGTGGAGACCGGCGGCC
GGCGCTGGAGCTGGCGCAAGATCAACAATGCCGATCTGGGCATTCCGAATGCCGTGCTGGCCGATTTCCG
CGAGGCGGCGCGGATCCGTGATGCCTTCTTCCCCGGCGGCGGCACCGTGCCCGATATCGGCTTCGACCTG
GTGCCGGTGTCGCTGACGCCGTCGGCCGCCCGGGTGGTGGTGGAGGTGAACGGCCAGACCGCCGCTTACG
ATCACGGGCCGGTGCGGCCGATGCCGCTGCGCTGGCCGGGCAATGGCCCGCAGCAGGTGCGCGTCACCTT
CATCGGCACCGACGGCACCCCGGCGGGCGGCACCAGCCTGACCGGCCCCTGGGCGCTGTTCCGGCTGATC
GACCGGTCGGAGGTGCGCCAGATCGCGAGCGACCGTTTCGAGGTGACCTTCAGGGCCGGGCAGAATGCCG
CGCGCTTCGAGGTTCGCGCCGGATCGGTGCTCAACCCCTTCTCTCTCGACGATCTGAGGTCGTTTTCATG
TCCGCGGCGCTTCTGA
 Primer design