SecReT6
Protein ID: 390950615
SecReT6 ID670
T6SS typei3
Gene symbol-
Locus tagThivi_2302
StrainThiocystis violascens DSM 198
Repliconchromosome [GenBank: NC_018012] [Browse all T6SS(s) in this replicon]
Location [Strand]2513732..2517283 [+]
Producttype VI secretion protein IcmF
NoteTssM
UniProt IDI3YB81
KEGG IDtvi:Thivi_2302
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 3.40E-95, Aligned region: 508..817
ImcF-related_N [PF14331], Evalue: 2.40E-92, Aligned region: 74..113
ImcF-related_N [PF14331], Evalue: 2.40E-92, Aligned region: 198..458
ImcF-related_N [PF14331], Evalue: 2.40E-92, Aligned region: 618..636
DUF1215 [PF06744], Evalue: 2.20E-32, Aligned region: 923..1043
AAA_16 [PF13191], Evalue: 0.00044, Aligned region: 123..257
AAA_16 [PF13191], Evalue: 0.00044, Aligned region: 414..430
AAA_16 [PF13191], Evalue: 0.00044, Aligned region: 720..790
AAA_33 [PF13671], Evalue: 0.0021, Aligned region: 134..228
AAA_33 [PF13671], Evalue: 0.0021, Aligned region: 414..428
AAA_22 [PF13401], Evalue: 0.0033, Aligned region: 134..196
AAA_22 [PF13401], Evalue: 0.0033, Aligned region: 414..430
AAA_22 [PF13401], Evalue: 0.0033, Aligned region: 574..634
AAA_19 [PF13245], Evalue: 0.0072, Aligned region: 134..149
AAA_19 [PF13245], Evalue: 0.0072, Aligned region: 748..770
Protein Sequence: 1183 a.a.     [Download]
>gi|390950615|ref|YP_006414374.1| type VI secretion protein IcmF [Thiocystis violascens DSM 198]
MKWLQRFFASRFFLSLVGTVALALLVWFVGPLIGFSGAEPLASALHRWILIGGLFSVWGLTQIGAAVWAR
IRNRQLMEQLAAGPEPAADPAKLASEDELRALRERFDQALATLKESGGKQKLGGRWVYQLPWYLIIGPPG
CGKTTALLHSGLRFPLAERLGQDAIHGIGGTRHCDWWFTDEAVLIDTAGRYTTQDSYEEVDRAAWQNFLA
LLKKHRPRRPINGVLVAVSLSDLMQLSQAERDAHALAIRQRVQELCQSFGIAVPVYVLFMKADLVAGFSE
FFADLTKEGREQVWGMTFQSAPREDSPAPLTAFPEEMKALHARLDQRLLTRLEQEREPGKRTLLFSFPSQ
FGALGETLERFLNDAFAPSRFEIQPLVRGVYFTSGTQTGTPIDRILGAYAANFGLGRQGLLPFKGTGKSY
FLNRLLREVIFQESGLAGLDPRLERRRLWLRRGAYAGAALVFLIAATAWATSYARNRAYIEDVAQRVVDI
EARIDALTPEERDPLDALPLLDAARAIPRGFAERDRRVPLSMGLGLYQGEKLGSQSELAYRRILNKVLLP
RVILRLEEQIRQSAAGNPDALYEALRVYLMLDSETHYDPTAVKRWVERDWQDSLPRETTTEQHAALRDHL
DALMERRPVPLPLELDRSLIDQARGILNRSPLPERVYDRLTREGLGNAIRDFTVSDAAGEYANLVFVRRS
GRPLNQGVPALYTYDGYHRGFTAASSRLIAEAAAESWVLGPDARLKSGTGDVRQLLDAIRDLYLRDYANV
WKDLLDDLELIAVRDLRHAAQVMDILADPTQSPLRRLLTAAARQTELDRKPEPTEAAVPTPSSPDAVRRR
VEGYLGDPSPNTTPGGSPESYVTNRFTWLHDLVNPDAQGRAPIDQLQTTLSKLELHLTGVAAAMASGRDL
LVAGETAEIQDTKALAGKLPAPLGEWIGTLAQDSANLEAGGMRAQINSLWTSEILPFCREAINDRYPFVQ
GSARETTLFDFGRLLGPEGMIDTFFKKNLAPIVNTSRPTWRWVDASLGIPNEVLAQFQRAAVIREAFFMG
GGKTPAVEFELQPTSMDARATQFILDLGGQIVDYRQGPPRSQRLKWPAPDGPARVRLTFMDATGSGPSLT
EEGPWAWFRILDKSSLKPTNQPEKFQVAFSLGGLSARFELRAVSVRNPFHLQEVRQFRCPERL
 
Nucleotide Sequence: 3552 bp     [Download]
>gi|390948458|ref|NC_018012.1|:2513732-2517283 Thiocystis violascens DSM 198 chromosome, complete genome
ATGAAGTGGTTGCAACGTTTTTTCGCGTCGCGTTTTTTCCTGAGCCTGGTCGGAACGGTCGCGCTGGCGC
TGTTGGTCTGGTTCGTCGGACCGTTGATCGGCTTCTCCGGCGCCGAACCGCTCGCCTCGGCGCTCCATCG
CTGGATCCTCATCGGGGGGCTGTTCAGTGTCTGGGGTCTGACCCAGATCGGCGCTGCCGTCTGGGCACGC
ATCCGCAACCGTCAGCTCATGGAGCAACTCGCCGCCGGTCCCGAACCGGCGGCGGATCCGGCCAAGCTCG
CCTCGGAGGACGAATTACGGGCGCTGCGCGAACGCTTCGACCAGGCCCTAGCAACGCTCAAGGAATCCGG
CGGCAAGCAAAAGCTAGGCGGACGCTGGGTCTACCAACTGCCCTGGTACCTCATCATCGGCCCGCCCGGC
TGCGGCAAGACCACGGCACTGCTCCATTCTGGGCTACGCTTTCCGCTCGCCGAACGGCTGGGTCAGGACG
CGATCCACGGGATCGGCGGCACCCGTCATTGCGACTGGTGGTTCACCGACGAGGCGGTGCTGATCGATAC
CGCCGGACGCTATACCACCCAGGACAGTTATGAAGAGGTGGACCGGGCGGCCTGGCAGAATTTTCTGGCC
CTGCTGAAAAAACATCGTCCGCGTCGCCCCATCAATGGCGTGCTGGTGGCCGTCAGTCTCTCCGACCTGA
TGCAACTGTCCCAGGCCGAGCGCGACGCCCATGCCCTGGCCATTCGTCAGCGCGTCCAGGAATTGTGCCA
GTCATTCGGCATTGCGGTGCCCGTCTACGTGCTTTTCATGAAAGCGGACCTGGTGGCCGGATTCAGCGAG
TTCTTCGCCGACCTGACGAAGGAGGGACGCGAACAGGTCTGGGGCATGACCTTTCAATCCGCGCCGCGCG
AGGACTCGCCGGCTCCCCTCACGGCCTTCCCGGAGGAGATGAAGGCGCTGCACGCGCGACTCGACCAACG
TCTGCTGACCCGTCTGGAACAGGAGCGCGAACCAGGCAAGCGGACACTGCTGTTCAGCTTCCCAAGCCAG
TTCGGCGCGCTCGGGGAAACGCTGGAGCGCTTCCTGAACGACGCCTTCGCGCCCTCCCGCTTCGAGATTC
AGCCGCTGGTGCGCGGCGTCTATTTCACCAGCGGCACCCAAACCGGCACCCCGATCGACCGCATCCTGGG
CGCCTATGCCGCCAACTTCGGACTGGGTCGTCAGGGTCTGCTGCCCTTCAAGGGAACCGGCAAGAGTTAC
TTCCTCAACCGTCTGCTGCGCGAGGTCATCTTTCAGGAATCCGGCCTGGCCGGACTCGACCCGCGTCTGG
AGCGTCGCCGTCTCTGGCTGCGCCGTGGCGCCTACGCTGGCGCCGCTTTGGTCTTTCTGATCGCGGCGAC
CGCCTGGGCCACCAGCTATGCACGCAATCGCGCCTATATCGAGGACGTCGCGCAGCGTGTCGTGGACATC
GAGGCGCGCATCGACGCACTGACGCCCGAGGAACGCGACCCGCTGGACGCGCTGCCCTTGCTGGACGCCG
CGCGCGCCATTCCGCGCGGTTTTGCCGAACGCGACCGCCGCGTCCCGCTGAGCATGGGACTAGGGCTCTA
TCAGGGCGAGAAATTGGGCTCCCAGTCCGAACTCGCCTATCGGCGCATCCTCAACAAGGTACTGCTACCG
CGCGTCATCCTGCGGCTTGAGGAACAAATCCGGCAGTCCGCCGCCGGCAACCCCGACGCGCTCTACGAGG
CCTTGCGCGTCTATCTGATGCTGGACAGCGAAACCCACTATGACCCCACCGCCGTGAAGCGCTGGGTCGA
ACGCGACTGGCAGGATAGCCTACCGCGCGAGACCACGACCGAGCAGCACGCGGCCCTACGCGACCACCTG
GATGCGCTCATGGAGCGCCGCCCGGTTCCGCTGCCGCTCGAACTCGATCGCAGTCTGATCGACCAGGCGC
GGGGCATCCTCAACCGCTCGCCGCTGCCCGAACGGGTCTATGACCGACTCACGCGCGAGGGGCTGGGCAA
TGCGATCCGCGACTTCACGGTCAGCGACGCCGCCGGCGAATACGCCAACCTGGTGTTCGTGCGCCGTAGC
GGTCGGCCGCTCAACCAGGGCGTCCCCGCGCTCTATACCTATGACGGATACCATCGCGGGTTTACGGCGG
CAAGCAGTCGCCTGATCGCGGAGGCCGCCGCGGAAAGCTGGGTACTCGGCCCGGATGCGCGCTTGAAATC
GGGAACCGGGGACGTCCGGCAACTGCTCGACGCGATCCGCGACCTGTATCTGCGCGACTATGCCAACGTC
TGGAAGGATCTGCTCGACGATCTCGAACTCATCGCCGTGCGCGACCTGCGGCACGCCGCTCAAGTCATGG
ACATCCTCGCCGACCCCACCCAATCCCCGCTGCGCCGCCTGCTGACCGCCGCCGCGCGACAGACCGAACT
CGACCGCAAGCCCGAGCCGACTGAAGCCGCCGTTCCGACCCCCAGCAGTCCGGATGCCGTTAGACGGCGT
GTCGAGGGCTATCTGGGCGATCCGTCCCCGAATACCACGCCCGGCGGATCGCCGGAGTCCTATGTCACGA
ACCGCTTTACCTGGCTGCACGATCTGGTGAACCCAGACGCACAGGGTCGAGCGCCCATCGACCAGTTGCA
GACCACCTTGAGCAAGCTGGAGCTTCATCTCACCGGCGTGGCCGCCGCGATGGCATCCGGGCGCGATCTG
CTGGTCGCCGGAGAGACCGCCGAGATCCAGGACACCAAGGCGCTCGCGGGCAAGCTCCCGGCACCGCTGG
GCGAATGGATCGGCACCCTGGCGCAGGATAGCGCCAATCTCGAAGCCGGCGGCATGCGCGCCCAGATCAA
CAGCCTCTGGACCTCCGAGATCCTGCCCTTCTGCCGCGAAGCGATCAACGACCGTTACCCCTTTGTCCAG
GGTAGCGCGCGCGAGACGACGCTCTTCGATTTCGGGCGCCTGCTTGGTCCAGAAGGCATGATCGATACGT
TTTTCAAGAAGAATCTGGCCCCGATCGTCAATACCTCGCGACCGACCTGGCGTTGGGTCGACGCCAGCCT
GGGCATTCCGAACGAGGTGCTGGCGCAATTCCAACGCGCGGCCGTCATCCGCGAGGCGTTTTTCATGGGG
GGCGGCAAGACGCCAGCGGTCGAATTCGAGTTGCAACCCACGAGCATGGATGCGCGGGCAACGCAGTTCA
TCCTGGATCTCGGCGGACAGATCGTCGATTACCGACAGGGTCCGCCGCGCAGTCAACGGCTGAAATGGCC
CGCGCCGGACGGACCGGCACGGGTTCGGCTGACCTTCATGGACGCCACCGGCAGCGGCCCGAGTCTGACC
GAGGAAGGCCCATGGGCCTGGTTTCGGATTCTGGATAAATCCTCCTTGAAACCGACCAATCAACCGGAAA
AATTTCAGGTCGCCTTTTCGCTGGGCGGACTGTCCGCGCGTTTCGAGCTGCGCGCGGTCAGCGTGCGCAA
CCCCTTTCACCTCCAGGAAGTGCGTCAATTTCGCTGTCCGGAGCGATTGTGA
 Primer design