SecReT6
Protein ID: 392378680
SecReT6 ID519
T6SS typei4a
Gene symbol-
Locus tagAZOBR_p1140126
StrainAzospirillum brasilense Sp245
Repliconplasmid AZOBR_p1 [GenBank: NC_016594] [Browse all T6SS(s) in this replicon]
Location [Strand]1541932..1544007 [-]
Producthypothetical protein
NoteTssI
UniProt IDG8APD8
KEGG IDabs:AZOBR_p1140126
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.90E-76, Aligned region: 31..330
Phage_GPD [PF05954], Evalue: 1.90E-76, Aligned region: 536..573
Phage_base_V [PF04717], Evalue: 1.40E-25, Aligned region: 360..452
Gp5_C [PF06715], Evalue: 9.40E-13, Aligned region: 495..517
Gp5_C [PF06715], Evalue: 9.40E-13, Aligned region: 519..541
Gp5_C [PF06715], Evalue: 9.40E-13, Aligned region: 543..565
Gp5_C [PF06715], Evalue: 9.40E-13, Aligned region: 576..594
Protein Sequence: 691 a.a.     [Download]
>gi|392378680|ref|YP_004985840.1| conserved protein of unknown function [Azospirillum brasilense Sp245]
MAKRFSQDGQYLSITTPLGADALALRTIVGEERLSSLFTYRVTMISSDEDIAFDRVVGKAVTVAITLGDQ
ETVRYINAIVGRIELTHVDDRGQVAHYEAELHPWLWMLTHSGDCRIFQEKTVPEIVEEVCKGAGYTDLKK
SLTGTYAKREYCVQYRETDYNFVARLLEEEGIFYYFAHEDGKHTLVLGDGANAFAKSTLLDAFEYRTTEG
HDDEDHVLNGLSVERRVTTKSYGIDGYHFETPSTDLYATAEGASGFGTVSDYMGRHTTSSDGEAMAKLRQ
QALAFPGRRVRGSGECRSLEAGTRITVSGHSKSDLNAEYVLYSVRIDGASGHFNAHFTAFPPDLPFRPLD
TAVKPRIHSTQTAIVVGKSGEEIWLDKYGRIKVQFHWDRLGKKDEKSSCWVRVAQNWAGKNYGIMFFPRV
GQEVVVTFLDGDPDRPLVTGSVYNAEQTVPYTLPDDSTKSTIKTQTSKNGTGKFNEIRFEDKADAEEIFV
HAQKDMNVEVLNDVTRLVKHDEVETVENDSTIDIQHDRKLTVKNDHSITVSDGNETHEVAKGTRAVTVKG
NETHTNKADFIHKADGDYTLTVKGNLTIDVTGDVVIKGKSVKVTATSGEVAVKSGTDMKLDAGGAFNAKS
GMAMEIKSGMGMDVKASMGMNLKAGMALTAEGLSATLKAQTMGEVSAGAIMTVKGTLVKVN
 
Nucleotide Sequence: 2076 bp     [Download]
>gi|392377157|ref|NC_016594.1|:c1544007-1541932 Azospirillum brasilense Sp245 plasmid AZOBR_p1, complete sequence
ATGGCGAAGCGCTTTTCCCAGGACGGCCAGTATCTGTCCATCACCACCCCGCTGGGGGCGGACGCGCTGG
CGCTGCGCACCATCGTGGGGGAGGAGCGGCTGTCGTCGCTGTTCACCTACCGCGTCACGATGATCTCGTC
GGACGAGGACATCGCCTTCGACCGCGTCGTCGGCAAGGCGGTGACCGTCGCCATCACGCTCGGCGACCAG
GAGACGGTGCGCTACATCAACGCCATCGTCGGGCGGATCGAACTGACCCACGTCGACGACCGCGGCCAGG
TCGCCCATTACGAGGCGGAGCTTCACCCCTGGCTGTGGATGCTGACCCATTCCGGCGACTGCCGCATCTT
CCAGGAGAAGACGGTCCCGGAAATCGTCGAGGAGGTCTGCAAGGGCGCCGGCTACACCGACCTCAAGAAA
TCGCTGACCGGCACCTACGCCAAGCGCGAATATTGCGTGCAGTACCGCGAGACCGACTACAACTTCGTCG
CCCGTCTGCTCGAAGAGGAAGGCATCTTCTATTACTTCGCGCATGAGGACGGGAAGCACACGCTGGTGCT
GGGCGACGGGGCCAACGCCTTCGCCAAGAGCACGCTGCTCGACGCTTTCGAATACCGCACCACCGAAGGG
CACGACGACGAGGACCATGTGCTGAACGGGCTCAGCGTCGAGCGCCGCGTGACGACCAAGAGCTACGGCA
TCGACGGCTACCATTTCGAGACGCCCTCAACCGATCTCTACGCCACGGCCGAGGGCGCGTCGGGCTTCGG
CACGGTCAGCGACTACATGGGCCGCCACACCACCTCGTCAGACGGTGAGGCGATGGCCAAGCTGCGCCAG
CAGGCGCTGGCCTTCCCCGGACGCCGGGTGCGCGGCAGCGGCGAATGCCGGTCGCTGGAGGCCGGGACGC
GCATCACCGTGTCCGGCCACAGCAAGAGCGACCTGAACGCCGAGTATGTCCTGTATTCCGTGCGCATCGA
CGGGGCGAGCGGCCATTTCAACGCCCATTTCACCGCCTTCCCGCCCGATCTGCCCTTCCGCCCGCTCGAC
ACGGCGGTGAAGCCGCGCATCCACTCCACCCAGACCGCCATCGTCGTCGGCAAGAGCGGGGAGGAGATCT
GGCTCGACAAATACGGGCGCATCAAGGTGCAGTTCCACTGGGACCGGCTGGGCAAGAAGGACGAGAAAAG
CTCCTGCTGGGTCCGCGTCGCGCAGAACTGGGCGGGCAAGAACTACGGCATCATGTTCTTCCCGCGCGTC
GGGCAAGAGGTGGTGGTGACCTTCCTCGACGGCGACCCCGACCGCCCACTGGTCACCGGCTCCGTCTACA
ACGCCGAGCAGACCGTGCCCTACACGCTGCCCGACGATTCGACCAAGAGCACCATCAAGACCCAGACCTC
GAAGAACGGCACCGGCAAGTTCAACGAGATCCGCTTCGAGGACAAGGCCGACGCCGAGGAGATTTTCGTT
CACGCCCAGAAGGACATGAACGTCGAGGTGTTGAACGACGTGACCCGCCTCGTCAAACACGACGAGGTGG
AGACGGTCGAGAACGACAGCACCATCGACATCCAGCACGACCGCAAGCTGACCGTGAAGAACGATCACAG
CATCACCGTGTCGGACGGCAACGAGACTCACGAGGTCGCGAAGGGCACGCGCGCCGTGACGGTGAAGGGG
AACGAGACCCACACCAACAAGGCGGACTTCATCCACAAGGCCGACGGCGACTACACCCTGACCGTGAAGG
GCAACCTGACCATCGACGTGACCGGCGACGTGGTCATCAAGGGCAAGTCGGTCAAGGTGACGGCCACCTC
CGGCGAAGTCGCCGTCAAGTCCGGCACGGACATGAAGCTCGACGCCGGCGGCGCCTTCAACGCCAAGTCC
GGCATGGCGATGGAGATCAAGTCGGGCATGGGCATGGACGTCAAGGCGAGCATGGGCATGAACCTGAAGG
CCGGGATGGCCCTGACCGCCGAGGGGCTGTCCGCCACGCTGAAGGCCCAGACCATGGGCGAGGTCAGCGC
CGGCGCCATCATGACCGTCAAAGGCACCCTGGTGAAGGTGAATTGA
 Primer design