SecReT6
Protein ID: 392378681
SecReT6 ID519
T6SS typei4a
Gene symbolclpV
Locus tagAZOBR_p1140127
StrainAzospirillum brasilense Sp245
Repliconplasmid AZOBR_p1 [GenBank: NC_016594] [Browse all T6SS(s) in this replicon]
Location [Strand]1544024..1546639 [-]
Productprotein clpV1
NoteTssH
UniProt IDG8APD9
KEGG IDabs:AZOBR_p1140127
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 5.60E-39, Aligned region: 227..244
AAA_2 [PF07724], Evalue: 5.60E-39, Aligned region: 594..765
AAA [PF00004], Evalue: 1.90E-17, Aligned region: 227..339
AAA [PF00004], Evalue: 1.90E-17, Aligned region: 600..717
AAA_5 [PF07728], Evalue: 2.40E-14, Aligned region: 227..247
AAA_5 [PF07728], Evalue: 2.40E-14, Aligned region: 327..357
AAA_5 [PF07728], Evalue: 2.40E-14, Aligned region: 599..718
AAA_16 [PF13191], Evalue: 5.70E-14, Aligned region: 204..249
AAA_16 [PF13191], Evalue: 5.70E-14, Aligned region: 272..306
AAA_16 [PF13191], Evalue: 5.70E-14, Aligned region: 371..431
AAA_16 [PF13191], Evalue: 5.70E-14, Aligned region: 568..644
AAA_16 [PF13191], Evalue: 5.70E-14, Aligned region: 664..693
AAA_16 [PF13191], Evalue: 5.70E-14, Aligned region: 750..805
ClpB_D2-small [PF10431], Evalue: 4.80E-13, Aligned region: 771..844
AAA_22 [PF13401], Evalue: 1.10E-07, Aligned region: 226..308
AAA_22 [PF13401], Evalue: 1.10E-07, Aligned region: 597..636
Clp_N [PF02861], Evalue: 1.70E-06, Aligned region: 26..74
AAA_25 [PF13481], Evalue: 2.10E-06, Aligned region: 221..300
AAA_25 [PF13481], Evalue: 2.10E-06, Aligned region: 597..634
IstB_IS21 [PF01695], Evalue: 6.10E-06, Aligned region: 209..249
IstB_IS21 [PF01695], Evalue: 6.10E-06, Aligned region: 484..514
IstB_IS21 [PF01695], Evalue: 6.10E-06, Aligned region: 599..617
Zeta_toxin [PF06414], Evalue: 1.10E-05, Aligned region: 224..247
Zeta_toxin [PF06414], Evalue: 1.10E-05, Aligned region: 307..361
Zeta_toxin [PF06414], Evalue: 1.10E-05, Aligned region: 479..518
Zeta_toxin [PF06414], Evalue: 1.10E-05, Aligned region: 593..640
AAA_17 [PF13207], Evalue: 1.20E-05, Aligned region: 227..261
AAA_17 [PF13207], Evalue: 1.20E-05, Aligned region: 598..638
AAA_19 [PF13245], Evalue: 2.10E-05, Aligned region: 224..253
AAA_19 [PF13245], Evalue: 2.10E-05, Aligned region: 597..618
AAA_18 [PF13238], Evalue: 6.10E-05, Aligned region: 227..247
AAA_18 [PF13238], Evalue: 6.10E-05, Aligned region: 600..628
Sigma54_activat [PF00158], Evalue: 7.10E-05, Aligned region: 205..241
Sigma54_activat [PF00158], Evalue: 7.10E-05, Aligned region: 599..698
NACHT [PF05729], Evalue: 0.00032, Aligned region: 227..253
NACHT [PF05729], Evalue: 0.00032, Aligned region: 599..624
AAA_29 [PF13555], Evalue: 0.00061, Aligned region: 217..243
AAA_29 [PF13555], Evalue: 0.00061, Aligned region: 597..623
TIP49 [PF06068], Evalue: 0.00086, Aligned region: 209..248
TIP49 [PF06068], Evalue: 0.00086, Aligned region: 276..307
TIP49 [PF06068], Evalue: 0.00086, Aligned region: 598..633
T2SE [PF00437], Evalue: 0.0049, Aligned region: 209..243
T2SE [PF00437], Evalue: 0.0049, Aligned region: 504..533
T2SE [PF00437], Evalue: 0.0049, Aligned region: 596..673
AAA_14 [PF13173], Evalue: 0.0057, Aligned region: 227..317
AAA_14 [PF13173], Evalue: 0.0057, Aligned region: 598..680
Mg_chelatase [PF01078], Evalue: 0.0095, Aligned region: 224..243
Mg_chelatase [PF01078], Evalue: 0.0095, Aligned region: 599..623
Protein Sequence: 871 a.a.     [Download]
>gi|392378681|ref|YP_004985841.1| protein clpV1 [Azospirillum brasilense Sp245]
MTADIKSLIGKLDRDGRKVLERSAALCVSQTHYDVEAEHVLLALLRLKDATVAGILRHYGVEAGRLETEL
DAALDRIRRGNSRTPAFSPRVPEMLETALLISVTHLDSPQILLPAILWAAVACDSVRAVITESAPSLLAL
PRERTASDLPELVRVLKEGGPSAAASDSSPTAAPLSAASDGRAMLDQYSQDLTAQAKAGKIDPVIGRDRE
IRQVIDVMMRRRQNNPILVGDPGVGKTAIVEGLALRIAEGDVPPPLRGMVIRTLDLGLLQAGAGVKGEFE
NRLKSIIKEVSASPVPMVVFIDEAHALIGAGGAAGQGDAANLLKPALARGEFRTIAATTWAEYKKYFEKD
PALARRFQPVSVPEPDETAAAAMLRGLVRRFEEHHGVSVLDDGIAAAVALSARYIPARQLPDKAISVLDT
ACARVAIARSSKPEAIEAMEREDAILAREAERLEAEPGTAHHARLSQISQRRGALSLEKAALDERWTREH
DLVNAVEAALKAGHAVEAAAAMEKLKAVQSDSPLVPHRVDGAVVAAVVSNWTGIPVGSMSKDDLEVVATL
EDRMAARVVGQPQALQAIARAVRGYRAGLGEPQRPIGVFLLSGPSGVGKTETALALAELLNGGEDSLITI
NMSEYQEAHAVATLRGAPPGYVGYGSGGVLTEAVRRRPHAVLLMDEVEKAHPDVLDMFYQVFDKGVLEDG
EGVEVDFRNTLILLTSNLGDTELFALGREALDAGRIGEAREDGLAAISDVLRRRFRPAFLGRLSVVPYYP
LSEAQIRRIVTMKLDKLQRRTAGNRGAELAVTDAAVEALVLRALNSDAGARMIDTLLSEFVVPEVAIRIL
DRVAAGQPVGRITVDHGADGRFTVSVDGTAA
 
Nucleotide Sequence: 2616 bp     [Download]
>gi|392377157|ref|NC_016594.1|:c1546639-1544024 Azospirillum brasilense Sp245 plasmid AZOBR_p1, complete sequence
GTGACCGCCGACATCAAGTCCCTCATCGGAAAGCTCGACCGCGACGGGCGCAAGGTTCTGGAACGCTCCG
CCGCGCTGTGCGTCTCGCAGACCCATTACGACGTCGAGGCGGAGCATGTGCTGCTGGCCCTGCTGCGGCT
GAAGGACGCTACCGTCGCCGGCATCCTGCGCCATTACGGCGTCGAGGCGGGCCGGCTGGAGACGGAACTG
GACGCGGCGCTGGACCGCATCCGCCGCGGCAACAGCCGCACCCCGGCCTTCTCCCCCCGCGTGCCAGAGA
TGCTGGAGACGGCGCTGCTGATCTCCGTCACCCATCTGGACAGCCCGCAGATCCTCCTCCCGGCCATCCT
CTGGGCCGCGGTCGCCTGCGATTCCGTGCGGGCGGTGATCACGGAGTCCGCCCCCTCGCTGCTCGCCCTG
CCGCGCGAGCGCACCGCGTCCGACCTGCCGGAACTGGTGCGCGTTCTGAAGGAGGGCGGACCGTCCGCCG
CCGCGTCCGACTCCTCTCCCACCGCCGCTCCGCTCTCCGCCGCGTCGGACGGGCGGGCCATGCTGGATCA
GTACAGCCAGGACCTGACCGCCCAGGCCAAGGCCGGGAAGATCGACCCGGTGATCGGGCGCGACCGCGAG
ATCCGGCAGGTCATCGACGTGATGATGCGCCGCCGCCAGAACAACCCGATCCTCGTCGGCGACCCCGGCG
TCGGCAAGACCGCCATTGTGGAAGGGCTGGCCCTGCGCATCGCCGAGGGCGACGTGCCGCCGCCGCTGCG
CGGCATGGTCATCCGCACGCTCGACCTCGGGCTGCTGCAAGCCGGAGCCGGGGTGAAGGGCGAGTTCGAG
AACCGGCTGAAGTCGATCATCAAGGAGGTCTCGGCCTCCCCCGTGCCGATGGTCGTCTTCATCGACGAGG
CGCACGCGCTGATCGGCGCCGGCGGAGCCGCTGGCCAGGGCGACGCCGCCAACCTGCTGAAGCCCGCCCT
GGCCCGTGGCGAGTTTCGCACCATCGCCGCCACCACCTGGGCCGAGTACAAGAAGTATTTCGAGAAGGAC
CCGGCGCTGGCCCGCCGCTTCCAGCCCGTCTCGGTGCCGGAACCGGACGAGACGGCGGCGGCCGCCATGC
TGCGCGGCCTCGTCCGCCGCTTCGAGGAGCATCACGGGGTCAGCGTGCTGGACGACGGCATCGCCGCCGC
GGTCGCCCTGTCCGCCCGCTACATCCCCGCCCGCCAGTTGCCTGACAAGGCGATCAGCGTGCTCGACACC
GCCTGCGCCCGCGTCGCCATCGCCCGCAGCTCCAAGCCCGAGGCCATCGAGGCGATGGAGCGCGAGGACG
CCATCCTCGCCCGCGAGGCGGAGCGGCTGGAGGCCGAACCCGGCACCGCCCACCACGCCCGCCTGTCGCA
GATTTCGCAACGCCGCGGCGCGCTCTCCCTGGAGAAGGCCGCGCTGGACGAGCGCTGGACGCGCGAGCAC
GATCTGGTCAATGCGGTGGAAGCCGCGCTGAAGGCCGGCCATGCGGTGGAGGCCGCCGCGGCCATGGAAA
AGCTGAAGGCCGTGCAGAGCGACAGCCCGCTGGTCCCGCACCGGGTGGACGGTGCGGTGGTCGCCGCCGT
GGTGTCGAACTGGACCGGCATCCCGGTCGGTTCGATGTCCAAGGACGACCTGGAGGTGGTCGCCACGCTG
GAGGACCGCATGGCCGCCCGCGTCGTCGGCCAGCCGCAGGCGCTCCAGGCCATCGCGCGGGCCGTGCGCG
GCTACCGCGCCGGGCTGGGCGAGCCGCAGCGCCCCATCGGCGTCTTCCTGCTGAGCGGCCCGAGCGGCGT
CGGCAAGACCGAAACCGCCCTGGCGCTCGCCGAGCTGCTGAACGGCGGCGAGGACAGCCTGATCACCATC
AACATGTCGGAGTATCAGGAGGCCCACGCCGTGGCGACGCTGCGCGGCGCCCCGCCGGGCTATGTCGGCT
ACGGCAGCGGCGGCGTGCTGACCGAGGCGGTGCGCCGCCGCCCCCACGCCGTGCTGCTGATGGACGAGGT
CGAAAAGGCCCACCCCGACGTGCTGGACATGTTCTATCAGGTCTTCGACAAGGGCGTTCTGGAGGACGGC
GAGGGGGTGGAGGTGGACTTCCGCAACACGCTGATCCTGCTGACCAGCAACCTGGGGGACACCGAGCTGT
TCGCATTGGGCCGCGAGGCGCTCGACGCCGGGCGCATCGGCGAGGCGCGGGAGGATGGGCTGGCCGCCAT
CTCCGACGTGCTGCGCCGCCGCTTCCGCCCGGCCTTCCTCGGCCGCCTGTCGGTCGTGCCCTATTACCCG
CTGAGCGAGGCGCAGATCCGCCGCATCGTGACGATGAAGCTGGACAAGCTGCAACGCCGCACCGCCGGCA
ACCGCGGCGCCGAGTTGGCCGTCACCGACGCGGCGGTGGAGGCGCTGGTTCTGCGGGCGCTGAACTCCGA
CGCCGGGGCGCGCATGATCGACACGCTGCTGTCGGAGTTCGTGGTGCCGGAGGTGGCGATCCGCATCCTC
GACCGCGTCGCCGCCGGCCAGCCGGTGGGCCGCATCACCGTGGACCACGGCGCGGACGGCCGCTTCACCG
TCAGCGTGGACGGCACGGCGGCCTGA
 Primer design