SecReT6
Protein ID: 392378682
SecReT6 ID519
T6SS typei4a
Gene symbol-
Locus tagAZOBR_p1140128
StrainAzospirillum brasilense Sp245
Repliconplasmid AZOBR_p1 [GenBank: NC_016594] [Browse all T6SS(s) in this replicon]
Location [Strand]1546636..1547739 [-]
Producthypothetical protein
NoteTssG
UniProt IDG8APE0
KEGG IDabs:AZOBR_p1140128
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.40E-86, Aligned region: 32..339
Protein Sequence: 367 a.a.     [Download]
>gi|392378682|ref|YP_004985842.1| conserved protein of unknown function [Azospirillum brasilense Sp245]
MVAPRRQPAGPVTDRPPPSSGQPPALIDRLEAEPWGFDLLQAIALLERAAPGLAPLGTGIDPEQEAVRIE
HDPSFVFPASDVVEARRTEDGRGVVRSPVLGVAGINGPLPYVATELLVERAARHDTAGSAFYDIFNHRLM
SIFYRTRQGSLPLLERDPERTLMARVLRALAGIGTPGLEQRLPGTPDRMLLAFSGILANRRRSSAGLEAI
LGAVFRVKVRVESFVGRWLPLDEESRTRIGGGFGARNNSLGRTVVLGRRVWDQQSCYAIELTLDSLERFR
EFLPDGRHHQTLCALARFHTGDGMDFRIVLVLEATKVPLTRLSTKPPEGSRLGWTSWLRAPGRPNVKDGR
LTLDPAPPATSSQGAVP
 
Nucleotide Sequence: 1104 bp     [Download]
>gi|392377157|ref|NC_016594.1|:c1547739-1546636 Azospirillum brasilense Sp245 plasmid AZOBR_p1, complete sequence
ATGGTCGCGCCTCGCCGGCAGCCAGCCGGTCCTGTGACGGACCGCCCTCCCCCCTCCTCGGGCCAGCCTC
CCGCCCTGATCGACCGGCTGGAGGCCGAGCCCTGGGGCTTCGACCTGCTGCAGGCCATCGCCCTGCTGGA
GCGCGCCGCCCCCGGCTTGGCCCCGCTCGGCACCGGCATCGACCCGGAGCAGGAGGCCGTCCGCATCGAG
CACGACCCCAGCTTCGTCTTCCCCGCCAGCGACGTGGTCGAGGCGCGGCGGACCGAGGACGGGCGCGGCG
TGGTGCGTTCCCCCGTTCTGGGCGTGGCGGGCATCAACGGCCCCCTGCCCTACGTCGCCACCGAACTGCT
CGTGGAGCGAGCGGCGCGACACGACACGGCGGGCTCGGCCTTCTACGACATCTTCAACCACCGCCTGATG
TCGATCTTCTACCGCACCCGCCAGGGCAGCCTCCCCCTGCTGGAGCGCGACCCGGAACGCACCCTGATGG
CCCGTGTGCTGCGCGCGCTGGCCGGAATCGGCACGCCCGGCCTGGAACAGCGCCTGCCCGGCACGCCCGA
CCGGATGCTGCTGGCCTTCTCCGGCATCCTCGCCAACCGGCGCCGTTCGTCGGCTGGGCTTGAGGCGATC
CTCGGCGCCGTCTTCCGGGTCAAGGTGCGGGTGGAGAGCTTCGTCGGGCGCTGGCTGCCGCTGGACGAGG
AGAGCCGGACCCGCATCGGCGGCGGCTTCGGCGCGCGGAACAACAGCCTCGGCCGCACCGTCGTGCTGGG
CCGCCGCGTCTGGGACCAGCAGAGCTGCTACGCCATCGAACTGACGCTCGACAGCCTGGAGCGCTTCCGC
GAGTTCCTGCCCGACGGGCGGCACCATCAGACCCTCTGCGCGCTCGCCCGCTTCCACACCGGGGACGGCA
TGGATTTTCGCATCGTGCTGGTGCTGGAAGCCACCAAGGTGCCGCTGACGCGCCTGTCCACCAAGCCGCC
GGAGGGCAGCCGCCTCGGCTGGACCTCCTGGCTGCGGGCGCCGGGCCGCCCGAATGTGAAGGACGGGCGC
CTGACCCTCGACCCCGCCCCGCCCGCAACGTCATCCCAGGGAGCCGTCCCGTGA
 Primer design