SecReT6
Protein ID: 392378683
SecReT6 ID519
T6SS typei4a
Gene symbol-
Locus tagAZOBR_p1140129
StrainAzospirillum brasilense Sp245
Repliconplasmid AZOBR_p1 [GenBank: NC_016594] [Browse all T6SS(s) in this replicon]
Location [Strand]1547703..1549499 [-]
Producthypothetical protein
NoteTssF
UniProt IDG8APE1
KEGG IDabs:AZOBR_p1140129
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 3.00E-182, Aligned region: 6..598
Protein Sequence: 598 a.a.     [Download]
>gi|392378683|ref|YP_004985843.1| conserved protein of unknown function [Azospirillum brasilense Sp245]
MRREDLLDHYERELLYVRRAGEAFARSYPKIARRLALGPDQAADPNVERLIESFAFLSGRLQLNLEREFP
RFSEALLGILHPQMIAPIPAMGIARMEPTPGEGRLTGGFRVPRGTPLHAVAEDNIRCRFRTAYDVTLWPV
AVTDAAVEPADRYDFLDGAATASVLRLRLETRNQSFENLPIDRLRLFIDGETILTSALHELFLCGVVEIA
YVQPGKPPVRLRGENLIAPVGFGPDETVLPHPKHAQPAYGLLQEYFEFPQKFDFYDLPLPQGRLSGEVVD
ILIAVSRPLPNRLTLRKDSFVLGCTPIVNLFNRTAEPIRLNHRRTAYRVVPDALRERTTEVHSILEVSGL
RDGDGMHHRYVPLFSHQHAEAETEPRGFWLAAREPTQREDVPGTDIHLSLHHLDLTPTDPADETLLVRTL
CTNRALAEQVPAGAALMIEESAPIATIRCLHKPTPGRPAPAGGSSAWKLISHLSVNHLSLTGDAEGLRAL
QSILLLHAPDDPSAQHQIRGVQGLSSRPVLHRMGQDAWRGFVRGLEVTVALDERNFVGASPLVFGGVLSR
FLGLYINVNAFAQLRLRSVQREGVWKAWSRLAGSQPVL
 
Nucleotide Sequence: 1797 bp     [Download]
>gi|392377157|ref|NC_016594.1|:c1549499-1547703 Azospirillum brasilense Sp245 plasmid AZOBR_p1, complete sequence
ATGCGGCGCGAGGACCTCCTCGACCATTACGAACGCGAGCTTCTCTACGTCCGCCGGGCGGGCGAAGCCT
TCGCGCGCAGCTATCCCAAGATCGCGCGCCGGCTGGCGCTGGGACCGGACCAAGCCGCCGACCCGAACGT
CGAGCGGCTGATCGAATCCTTCGCTTTCCTGTCGGGTCGCCTGCAACTCAATCTGGAGCGCGAATTCCCG
CGCTTCTCCGAAGCTCTGCTCGGCATCCTCCACCCGCAGATGATCGCGCCGATCCCGGCCATGGGCATCG
CGCGGATGGAGCCGACGCCCGGCGAGGGGCGGCTGACCGGCGGCTTCCGCGTGCCGCGCGGGACGCCGCT
GCACGCCGTGGCCGAGGACAACATCCGTTGCCGCTTCCGCACCGCCTACGACGTGACGCTGTGGCCGGTC
GCGGTGACCGACGCCGCGGTGGAGCCGGCGGACCGCTACGACTTCCTCGACGGCGCCGCCACCGCCTCGG
TGCTGCGGCTGCGGCTGGAAACGCGCAACCAGTCCTTCGAGAATCTGCCGATCGACAGGCTGCGCCTGTT
CATCGACGGCGAAACGATCCTCACATCCGCCCTGCACGAGCTGTTCCTGTGCGGCGTGGTCGAGATCGCC
TACGTCCAGCCCGGCAAGCCGCCGGTGCGGCTGCGCGGCGAGAACCTGATCGCCCCCGTGGGCTTCGGCC
CGGACGAGACGGTTCTGCCCCATCCCAAGCATGCCCAGCCGGCCTACGGCCTGTTGCAGGAATACTTCGA
GTTTCCGCAGAAGTTCGACTTCTACGACCTGCCGCTTCCGCAAGGCCGGCTGTCGGGCGAGGTCGTGGAC
ATCCTGATCGCGGTGTCGCGCCCGCTGCCCAACCGGCTGACCCTGCGCAAGGACAGCTTCGTCCTCGGCT
GCACGCCCATCGTCAACCTGTTCAACCGCACGGCGGAGCCGATCCGGCTGAACCACCGGCGCACCGCCTA
CCGCGTCGTTCCCGACGCCCTGCGCGAGCGCACGACCGAGGTCCATTCGATCCTGGAGGTCAGCGGCCTG
CGCGACGGCGACGGCATGCACCACCGCTACGTCCCCCTCTTTTCGCACCAGCACGCCGAGGCCGAAACGG
AGCCGCGCGGCTTCTGGCTGGCCGCGCGTGAGCCGACCCAGCGGGAGGACGTGCCGGGCACCGACATCCA
TCTCAGCCTGCACCACCTCGACCTGACGCCGACCGACCCGGCGGACGAGACGCTTCTGGTGCGCACGCTC
TGCACCAACCGCGCGCTGGCCGAGCAGGTGCCGGCGGGGGCGGCGCTGATGATCGAGGAATCCGCCCCCA
TCGCCACCATCCGCTGTCTGCACAAGCCGACGCCCGGCCGCCCGGCCCCGGCGGGCGGCTCCTCGGCCTG
GAAGCTGATCTCGCACCTGTCGGTCAACCATCTCAGCCTCACCGGCGACGCCGAGGGGCTGCGCGCCCTG
CAATCCATCCTGCTGCTGCACGCGCCCGACGATCCGTCCGCCCAGCACCAGATCCGCGGCGTGCAGGGCC
TGTCCTCCCGCCCGGTGCTGCACCGCATGGGACAGGACGCCTGGCGCGGCTTCGTGCGCGGGCTGGAGGT
GACGGTGGCACTGGACGAGCGGAACTTCGTCGGCGCCAGCCCGCTGGTCTTCGGCGGCGTGCTCAGCCGC
TTCCTCGGGCTCTACATCAACGTCAACGCCTTCGCCCAGCTTCGGCTGCGCTCGGTGCAACGGGAAGGGG
TCTGGAAGGCATGGTCGCGCCTCGCCGGCAGCCAGCCGGTCCTGTGA
 Primer design