SecReT6
Protein ID: 392378684
SecReT6 ID519
T6SS typei4a
Gene symbol-
Locus tagAZOBR_p1140130
StrainAzospirillum brasilense Sp245
Repliconplasmid AZOBR_p1 [GenBank: NC_016594] [Browse all T6SS(s) in this replicon]
Location [Strand]1549514..1549987 [-]
Producthypothetical protein
NoteTssE
UniProt IDG8APE2
KEGG IDabs:AZOBR_p1140130
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 4.80E-16, Aligned region: 38..138
Protein Sequence: 157 a.a.     [Download]
>gi|392378684|ref|YP_004985844.1| conserved protein of unknown function [Azospirillum brasilense Sp245]
MTQPKTMTGGRSLLFERLIDFEPDHPTGDEPSATVLSMPDLKASIQREVARILDSRSTGTRRPDLGGTAL
DYGISDITHLDAASDADRRQVERMVRQAIIDFEPRLKRPRVTVSAGTGRGTMVTSISGEVVAGTVTERLE
FDVGLRGPAATEPSQSG
 
Nucleotide Sequence: 474 bp     [Download]
>gi|392377157|ref|NC_016594.1|:c1549987-1549514 Azospirillum brasilense Sp245 plasmid AZOBR_p1, complete sequence
ATGACCCAGCCCAAGACGATGACCGGCGGACGGTCGCTGCTGTTCGAACGGCTGATCGACTTCGAACCGG
ACCACCCGACGGGCGACGAGCCGTCCGCCACGGTGCTGTCCATGCCCGACCTCAAGGCGTCGATTCAGCG
CGAGGTGGCGCGCATCCTCGACAGCCGCAGCACCGGCACGCGCCGCCCCGACCTCGGCGGAACGGCGCTG
GACTATGGGATTTCCGACATCACGCATCTGGACGCCGCTTCCGACGCCGACCGCCGTCAGGTGGAGCGGA
TGGTGCGGCAGGCCATCATCGATTTCGAGCCGCGGCTGAAGCGCCCGCGGGTGACCGTCAGCGCCGGAAC
CGGGCGCGGCACCATGGTCACCAGCATCTCCGGCGAGGTCGTGGCGGGCACCGTCACCGAACGGCTGGAG
TTCGACGTGGGCCTGCGCGGCCCGGCCGCCACCGAGCCAAGCCAGTCCGGCTGA
 Primer design