SecReT6
Protein ID: 392378686
SecReT6 ID519
T6SS typei4a
Gene symbol-
Locus tagAZOBR_p1140132
StrainAzospirillum brasilense Sp245
Repliconplasmid AZOBR_p1 [GenBank: NC_016594] [Browse all T6SS(s) in this replicon]
Location [Strand]1550706..1552175 [-]
Producthypothetical protein
NoteTssC
UniProt IDG8APE4
KEGG IDabs:AZOBR_p1140132
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 4.80E-190, Aligned region: 62..485
Protein Sequence: 489 a.a.     [Download]
>gi|392378686|ref|YP_004985846.1| conserved protein of unknown function [Azospirillum brasilense Sp245]
MSTETSVESAASLSLLDRMMVEGKMAREEGQRPYARDLLTEFVDQVLAETGDASAIDVVEAINQRIAQID
ELISDQLNEVMHHPDFQKLEGTWRGLNYLVMNTETSTTLKLRVLNVSRKDLQKDLDSAVEFDQSAMFKMV
YEAEYGTLGGTPYSMLVGDYEFGRHPQDISLLEKMSNLAAAAHAPFISAVSPAMFDMENFGELGAPRDLS
KIFETAEMVKWRSFRSSEDSRYVSLTMPHVLMRLPYGPNTVPVEGMNFVEDTDGRDHSKYLWGNASWALA
ARITDSFAKHGWTAAIRGVEGGGKVEGLPSHTFKTDEGDVALKCPTEIAITDRREKELNDLGFISLVHCK
NTDYAAFFSGQTTNKPKVYNTDEANANARISAMLPYMLVSSRFAHYLKVMLRDKIGAFLTRNNITDHLNT
WIANYVLLDDEASQGTKARFPLREARIDVYDVPGRPGVYRANIFLRPHFQLEELSASIRMVAELPAPEA
 
Nucleotide Sequence: 1470 bp     [Download]
>gi|392377157|ref|NC_016594.1|:c1552175-1550706 Azospirillum brasilense Sp245 plasmid AZOBR_p1, complete sequence
GTGAGCACGGAAACGTCCGTTGAGAGCGCCGCCAGTCTGTCCCTGCTCGACCGCATGATGGTCGAAGGCA
AGATGGCGCGCGAAGAGGGCCAGCGGCCCTACGCCCGCGACCTTCTGACCGAATTCGTCGACCAGGTCCT
CGCCGAGACCGGCGACGCCTCCGCCATCGACGTGGTCGAGGCGATCAACCAGCGCATCGCGCAGATCGAC
GAGCTGATCAGCGACCAGCTGAACGAGGTCATGCACCACCCCGACTTCCAGAAGCTGGAAGGCACGTGGC
GCGGCCTCAACTACCTCGTCATGAACACCGAGACCTCGACGACGCTGAAGCTGCGCGTCCTCAACGTCTC
GCGCAAGGACCTTCAGAAGGACCTGGACAGCGCGGTCGAGTTCGACCAGAGCGCCATGTTCAAGATGGTC
TACGAGGCCGAGTACGGCACGCTGGGCGGCACGCCCTACAGCATGCTGGTCGGTGATTACGAGTTCGGCC
GCCATCCGCAGGACATCTCCCTGCTGGAGAAGATGTCGAACCTCGCCGCCGCCGCCCACGCGCCGTTCAT
CAGCGCCGTGTCGCCGGCGATGTTCGACATGGAGAACTTCGGCGAGCTGGGCGCCCCGCGCGACCTGTCG
AAGATCTTCGAGACGGCCGAGATGGTGAAGTGGCGGTCCTTCCGTTCGTCGGAGGATTCCCGCTACGTCT
CGCTGACCATGCCGCACGTCCTGATGCGCCTGCCCTACGGCCCGAACACCGTTCCGGTCGAAGGCATGAA
TTTCGTCGAGGACACCGACGGGCGCGATCATTCCAAGTACCTGTGGGGCAACGCCTCCTGGGCGCTGGCC
GCGCGCATCACCGACAGCTTCGCCAAGCACGGCTGGACCGCGGCCATCCGCGGCGTCGAAGGCGGCGGCA
AGGTCGAGGGTCTGCCCAGCCACACCTTCAAGACCGACGAGGGCGACGTCGCCCTGAAGTGCCCGACGGA
GATCGCCATCACCGATCGCCGTGAGAAGGAGCTGAACGACCTCGGCTTCATCTCGCTGGTCCACTGCAAG
AACACGGATTACGCGGCGTTCTTCAGCGGCCAGACCACCAACAAGCCGAAGGTCTACAACACCGACGAGG
CCAACGCGAACGCCCGCATCTCCGCGATGCTGCCGTACATGCTGGTGTCGTCGCGCTTCGCCCATTACCT
GAAGGTGATGCTGCGCGACAAGATCGGCGCCTTCCTGACGCGCAACAACATCACGGACCACCTGAACACC
TGGATCGCCAACTACGTCCTTCTGGACGACGAGGCGTCGCAGGGCACGAAGGCCCGTTTCCCGCTGCGCG
AGGCCCGCATCGACGTCTACGACGTGCCGGGCCGTCCGGGCGTCTACCGCGCCAACATCTTCCTGCGTCC
GCATTTCCAGCTCGAAGAGCTGTCGGCCTCCATCCGCATGGTCGCCGAACTGCCGGCGCCGGAAGCCTGA
 Primer design