SecReT6
Protein ID: 392378687
SecReT6 ID519
T6SS typei4a
Gene symbol-
Locus tagAZOBR_p1140133
StrainAzospirillum brasilense Sp245
Repliconplasmid AZOBR_p1 [GenBank: NC_016594] [Browse all T6SS(s) in this replicon]
Location [Strand]1552225..1552761 [-]
Producthypothetical protein
NoteTssB
UniProt IDG8APE5
KEGG IDabs:AZOBR_p1140133
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 1.70E-53, Aligned region: 9..161
Protein Sequence: 178 a.a.     [Download]
>gi|392378687|ref|YP_004985847.1| conserved protein of unknown function [Azospirillum brasilense Sp245]
MSESSQKKLERVRPPRVKLTYEVHTGGAQEMKELPFLVGILADLSGKPEKPLPKLKERKFVEIDRDNFND
VMASVGPRLAFQVDNKLQEDGGKLNILLNMRHMDDFQPVEVLKQVPTLSRLFEARQKLSDLLAKLDGNDE
LNGLLNDVITSTEQQDELKKLLGPVAGAPAGEPAGEPA
 
Nucleotide Sequence: 537 bp     [Download]
>gi|392377157|ref|NC_016594.1|:c1552761-1552225 Azospirillum brasilense Sp245 plasmid AZOBR_p1, complete sequence
ATGAGCGAGAGCAGTCAGAAGAAGTTGGAGCGCGTCCGCCCGCCGCGGGTGAAGCTCACCTACGAGGTCC
ACACCGGTGGCGCCCAGGAGATGAAGGAGCTGCCCTTCCTGGTCGGCATCCTGGCCGATCTCAGCGGCAA
GCCGGAGAAGCCCCTTCCCAAGCTGAAGGAGCGCAAGTTCGTCGAGATCGACCGCGACAACTTCAACGAC
GTGATGGCCTCCGTCGGGCCGCGCCTCGCCTTCCAGGTGGACAACAAGCTGCAGGAGGACGGCGGCAAGC
TGAACATCCTGCTGAACATGCGCCACATGGACGATTTCCAGCCGGTGGAGGTGCTGAAGCAGGTGCCGAC
GCTGAGCCGCCTGTTCGAAGCCCGGCAGAAGCTGTCGGATCTGCTGGCCAAGCTGGACGGCAACGACGAG
CTGAACGGCCTGCTGAACGACGTCATCACCAGCACCGAACAGCAGGACGAGCTGAAGAAGCTCCTCGGCC
CGGTGGCCGGCGCCCCGGCCGGCGAGCCCGCGGGCGAGCCCGCCTGA
 Primer design