SecReT6
Protein ID: 392378696
SecReT6 ID519
T6SS typei4a
Gene symbol-
Locus tagAZOBR_p1150005
StrainAzospirillum brasilense Sp245
Repliconplasmid AZOBR_p1 [GenBank: NC_016594] [Browse all T6SS(s) in this replicon]
Location [Strand]1559998..1560513 [+]
Productconserved exported protein of unknown function
NoteSPOR
UniProt IDG8APF4
KEGG IDabs:AZOBR_p1150005
PDB IDNA
Domain hit(s) vs Pfam SPOR [PF05036], Evalue: 2.60E-12, Aligned region: 82..155
Protein Sequence: 171 a.a.     [Download]
>gi|392378696|ref|YP_004985856.1| conserved exported protein of unknown function [Azospirillum brasilense Sp245]
MKKLLIGVLALLLLLVAFVGGYFLAGGALPGAAEDPAPSGANAAPATPAAGPQDAAKAEPEKVAPAAVPV
RPVATVKATTARFSIELGVFRSAGNAQDFAAALAGRGLPVEIVETMDAAGGQWHRVRAGAFADRWQAEAR
RPSFERTAGIGGVVVEEPLAATQPAKAGGGE
 
Nucleotide Sequence: 516 bp     [Download]
>gi|392377157|ref|NC_016594.1|:1559998-1560513 Azospirillum brasilense Sp245 plasmid AZOBR_p1, complete sequence
ATGAAGAAACTCCTGATCGGCGTGCTGGCGCTGTTGCTGCTCCTGGTGGCCTTTGTGGGCGGCTATTTCC
TGGCCGGGGGGGCGTTGCCGGGCGCGGCGGAGGATCCGGCTCCCTCCGGGGCGAACGCCGCGCCGGCCAC
GCCCGCCGCAGGGCCACAGGACGCGGCGAAGGCGGAGCCGGAGAAGGTCGCCCCGGCCGCCGTCCCGGTC
CGTCCGGTTGCTACCGTGAAGGCGACGACGGCGCGCTTCTCCATCGAACTCGGCGTCTTCCGCTCCGCCG
GGAACGCCCAGGATTTCGCAGCGGCGCTGGCCGGGCGGGGCCTTCCGGTGGAGATCGTCGAGACCATGGA
CGCCGCCGGGGGGCAGTGGCACCGGGTGCGCGCCGGCGCCTTCGCCGACCGCTGGCAGGCCGAGGCGCGC
CGCCCGTCCTTCGAGCGGACCGCCGGGATCGGCGGGGTGGTGGTCGAGGAGCCGCTTGCCGCCACCCAGC
CCGCGAAGGCCGGCGGCGGCGAATGA
 Primer design