SecReT6
Protein ID: 392378697
SecReT6 ID519
T6SS typei4a
Gene symbol-
Locus tagAZOBR_p1150006
StrainAzospirillum brasilense Sp245
Repliconplasmid AZOBR_p1 [GenBank: NC_016594] [Browse all T6SS(s) in this replicon]
Location [Strand]1560730..1561494 [+]
Productconserved exported protein of unknown function
NoteSPOR
UniProt IDG8APF5
KEGG IDabs:AZOBR_p1150006
PDB IDNA
Domain hit(s) vs Pfam SPOR [PF05036], Evalue: 9.10E-11, Aligned region: 110..122
SPOR [PF05036], Evalue: 9.10E-11, Aligned region: 172..247
Protein Sequence: 254 a.a.     [Download]
>gi|392378697|ref|YP_004985857.1| conserved exported protein of unknown function [Azospirillum brasilense Sp245]
MTTITLGRWQVAALAAGVAVLTVVALLLGAVMAALILTGGGDTPMASASAPATTSAATTAGAPAAGGGLG
AMARSGVADSFEARQGVIETADIFSDQARGRAISATEPVTRGAADAARRLLPGWMAGTAAHVIEKTGYRV
TEFAGNSVEGIVEDTLNDRLDAMKDGGAAPVRHYAIELGRFATPANAESFAAAAAQRGVRGTVDFAPLPG
GNAPYAVRTGRYAAADEAARALDALTRANGVSGTVVTLAEAGER
 
Nucleotide Sequence: 765 bp     [Download]
>gi|392377157|ref|NC_016594.1|:1560730-1561494 Azospirillum brasilense Sp245 plasmid AZOBR_p1, complete sequence
ATGACCACGATCACGCTCGGACGATGGCAGGTGGCGGCTCTGGCCGCTGGCGTCGCCGTGCTGACCGTCG
TGGCCCTGCTGCTCGGCGCGGTGATGGCGGCGCTGATCCTGACCGGAGGTGGAGACACGCCGATGGCGTC
GGCCTCCGCTCCCGCCACCACGTCCGCTGCCACGACCGCCGGAGCGCCCGCGGCCGGCGGCGGGCTGGGC
GCGATGGCGCGCAGCGGCGTCGCCGACAGCTTCGAGGCCCGCCAGGGCGTGATCGAGACGGCGGACATCT
TCAGCGACCAGGCGCGCGGACGGGCGATCTCCGCCACCGAGCCGGTGACCCGCGGCGCCGCGGACGCGGC
CCGCCGCCTCCTGCCCGGCTGGATGGCCGGCACCGCCGCCCACGTCATCGAAAAGACCGGCTACCGCGTC
ACCGAGTTCGCCGGCAACAGCGTGGAAGGCATCGTCGAGGACACGCTGAACGACCGGCTGGACGCGATGA
AGGACGGCGGGGCGGCGCCGGTCCGTCACTACGCCATCGAACTCGGGCGCTTCGCCACCCCGGCCAACGC
GGAGTCCTTCGCCGCCGCCGCCGCCCAGCGCGGCGTGCGCGGCACGGTCGATTTCGCGCCGCTGCCCGGC
GGCAACGCCCCCTACGCCGTGCGCACCGGACGCTACGCCGCGGCCGACGAGGCCGCCCGCGCGCTGGACG
CGCTGACGCGGGCGAACGGGGTGTCCGGAACCGTCGTCACCCTTGCCGAAGCGGGAGAGCGCTGA
 Primer design