SecReT6
Protein ID: 392378699
SecReT6 ID519
T6SS typei4a
Gene symbol-
Locus tagAZOBR_p1150008
StrainAzospirillum brasilense Sp245
Repliconplasmid AZOBR_p1 [GenBank: NC_016594] [Browse all T6SS(s) in this replicon]
Location [Strand]1561977..1563320 [+]
Producthypothetical protein
NoteTssK
UniProt IDG8APF7
KEGG IDabs:AZOBR_p1150008
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 2.30E-56, Aligned region: 23..393
Protein Sequence: 447 a.a.     [Download]
>gi|392378699|ref|YP_004985859.1| conserved protein of unknown function [Azospirillum brasilense Sp245]
MTEARDIPDAIDWHDGMLLAPQHFQQQALRHERQLTYHVRQARPFHWGVVHLQVDRVQLVSGLVQVRELE
AILPDGLVVDYRAGIDEPLEVDISAYADPVGQTQITIHLIVPAARGDRAPGPGETPRYVSVEGAPVADQH
GGEELSIARLRPRLALFATTGPTQKPPQKFASMPIAQATFRNDAFVLTDFVPPALTVAANAPLGRLGAEV
VRRVREKALFLAERSGVGNGNPATELAEAARAEIRSLVTGLPPLEAQLGVGVCHPFDVYMSLCTLAGHLS
AFASGAVPAKLSRYDHDDPMASFGEVRDFILRMIDRVKEGVARIPFTFEDGMFGLPMDEAWLKGRLVVGV
RGPASAPVSEVAAWMENCIVASRSRLETLSGLRVKGAERVALDDSGEGGVAAPRGVVPFEIKVDPRYIVP
GERLEIWNPDSLGSRFRPVEITLFVSA
 
Nucleotide Sequence: 1344 bp     [Download]
>gi|392377157|ref|NC_016594.1|:1561977-1563320 Azospirillum brasilense Sp245 plasmid AZOBR_p1, complete sequence
ATGACCGAGGCGCGCGACATTCCCGACGCCATCGACTGGCACGACGGGATGCTGCTGGCCCCGCAGCATT
TCCAGCAGCAGGCGCTGCGGCACGAGCGGCAGCTGACCTACCATGTCCGGCAGGCGCGGCCCTTCCATTG
GGGCGTCGTCCATCTTCAGGTCGACCGCGTGCAACTCGTCTCCGGGCTGGTCCAGGTGCGCGAGCTGGAG
GCGATCCTGCCCGACGGCCTCGTCGTGGACTACCGCGCCGGGATCGACGAGCCGCTGGAGGTGGACATCT
CCGCCTACGCCGACCCGGTGGGGCAGACGCAGATCACCATCCACCTGATCGTTCCCGCCGCCCGCGGCGA
CCGTGCGCCGGGGCCGGGGGAGACGCCGCGCTACGTCTCGGTCGAGGGCGCGCCGGTCGCCGACCAGCAT
GGCGGGGAGGAGCTGTCGATCGCCCGGCTGCGCCCGCGGCTGGCGCTGTTCGCCACCACCGGCCCGACGC
AGAAGCCGCCGCAGAAGTTCGCCTCCATGCCGATCGCGCAGGCGACCTTCCGCAACGACGCCTTCGTGCT
GACCGACTTCGTGCCGCCGGCGCTGACCGTTGCCGCCAACGCGCCGCTCGGCCGGCTGGGGGCGGAGGTG
GTGCGGCGCGTGCGCGAGAAGGCGCTGTTCCTGGCCGAGCGTTCCGGCGTGGGCAACGGCAACCCGGCGA
CCGAGCTGGCCGAGGCGGCGCGGGCGGAGATCCGCAGCCTCGTCACCGGCCTGCCCCCGCTGGAGGCGCA
GCTCGGCGTCGGCGTCTGCCACCCGTTCGATGTCTACATGTCGCTGTGCACGCTGGCCGGGCACCTGTCG
GCCTTTGCCAGCGGTGCCGTGCCGGCCAAGCTGTCGCGCTACGACCACGACGACCCGATGGCGAGCTTCG
GTGAGGTGCGCGATTTCATCCTGCGCATGATCGACCGGGTGAAGGAGGGCGTCGCCCGCATCCCCTTCAC
CTTCGAGGACGGCATGTTCGGGCTGCCGATGGACGAGGCCTGGCTGAAGGGCCGGCTGGTCGTCGGCGTG
CGCGGCCCGGCGTCGGCCCCGGTCAGCGAGGTCGCCGCCTGGATGGAGAACTGCATCGTCGCCTCCCGCT
CGCGGCTGGAGACGCTGTCCGGCCTGCGCGTGAAGGGGGCCGAGCGCGTCGCGCTGGACGACAGCGGCGA
GGGCGGTGTGGCCGCCCCGCGCGGCGTGGTGCCGTTCGAGATCAAGGTCGATCCCCGCTACATCGTCCCC
GGCGAGCGGCTGGAGATCTGGAACCCGGACTCGCTGGGCAGCCGCTTCCGCCCCGTCGAGATCACCCTCT
TCGTCAGCGCCTGA
 Primer design