SecReT6
Protein ID: 392378700
SecReT6 ID519
T6SS typei4a
Gene symbol-
Locus tagAZOBR_p1150009
StrainAzospirillum brasilense Sp245
Repliconplasmid AZOBR_p1 [GenBank: NC_016594] [Browse all T6SS(s) in this replicon]
Location [Strand]1563329..1564213 [+]
Producthypothetical protein
NoteTssL
UniProt IDG8APF8
KEGG IDabs:AZOBR_p1150009
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 9.20E-24, Aligned region: 87..265
Protein Sequence: 294 a.a.     [Download]
>gi|392378700|ref|YP_004985860.1| conserved protein of unknown function [Azospirillum brasilense Sp245]
MTAMLHRRDLVDHFLAFARELQKHRAAVGAGRPAAAAAKPEGAAGETADSLPAFLTEDALAIPAPRGGIA
AVPALALEPDAEIIIRRLQDFLEAQAVQVGRTGTDLMISQHREAQYAMAALADDLFIHDVEWNGRELWRS
VLLEQAVFRTRLAGERVFDRMEALLASNDRRLVQLAAVYLFVLGMGFKGRCRVPGGESTLRDYSARLFEF
IAGRESELGAGVLPGGRTLIPAAYAYTLTDGKARTLARGPRWPLVLGAIAGLWLVLGQALWWMSTAQLSN
AADAVLQASVRVTR
 
Nucleotide Sequence: 885 bp     [Download]
>gi|392377157|ref|NC_016594.1|:1563329-1564213 Azospirillum brasilense Sp245 plasmid AZOBR_p1, complete sequence
ATGACCGCCATGCTGCACCGCCGGGATCTGGTCGATCACTTCCTCGCCTTCGCGCGGGAACTCCAGAAGC
ACCGCGCCGCGGTCGGGGCGGGCCGTCCCGCCGCCGCTGCGGCGAAGCCAGAGGGCGCCGCGGGGGAGAC
GGCGGACAGCCTGCCGGCCTTTCTGACCGAGGACGCCCTGGCGATCCCGGCGCCCCGCGGTGGCATCGCG
GCGGTGCCGGCCCTGGCGCTGGAGCCCGACGCCGAGATCATCATCCGCCGCCTTCAGGACTTCCTGGAGG
CGCAGGCGGTCCAAGTCGGGCGCACCGGCACCGACCTGATGATCAGCCAGCACCGCGAGGCCCAATACGC
CATGGCGGCGCTGGCCGACGACCTGTTCATCCACGACGTGGAGTGGAACGGGCGGGAGCTGTGGCGCAGC
GTTCTGCTGGAGCAGGCGGTGTTCCGCACCCGGCTGGCCGGCGAGCGGGTGTTCGACCGCATGGAGGCGC
TGCTCGCCAGCAACGACCGTCGGCTGGTCCAGCTGGCGGCGGTGTATCTCTTCGTGCTCGGCATGGGCTT
CAAGGGGCGCTGCCGGGTGCCGGGCGGCGAATCCACCCTGCGCGACTACAGCGCCCGCCTGTTCGAGTTC
ATCGCCGGCCGCGAGTCCGAGCTGGGCGCCGGTGTGCTGCCCGGCGGGCGCACGCTGATCCCCGCTGCCT
ACGCCTACACGCTGACCGACGGCAAGGCGCGCACGCTGGCGCGCGGGCCGCGCTGGCCGCTGGTGCTGGG
GGCCATAGCCGGGCTGTGGCTGGTGCTGGGTCAGGCGCTCTGGTGGATGTCCACGGCGCAGCTTTCCAAC
GCGGCGGACGCGGTGCTTCAGGCATCGGTCCGCGTGACCCGCTGA
 Primer design