SecReT6
Protein ID: 392378702
SecReT6 ID519
T6SS typei4a
Gene symbol-
Locus tagAZOBR_p1150011
StrainAzospirillum brasilense Sp245
Repliconplasmid AZOBR_p1 [GenBank: NC_016594] [Browse all T6SS(s) in this replicon]
Location [Strand]1564684..1569480 [+]
Producthypothetical protein
NoteTssM
UniProt IDG8APG0
KEGG IDabs:AZOBR_p1150011
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 1.90E-27, Aligned region: 14..181
ImcF-related_N [PF14331], Evalue: 1.90E-27, Aligned region: 190..223
ImpA-rel_N [PF06812], Evalue: 2.30E-21, Aligned region: 1291..1352
Protein Sequence: 1598 a.a.     [Download]
>gi|392378702|ref|YP_004985862.1| conserved protein of unknown function [Azospirillum brasilense Sp245]
MTIPAPPGPACSTLLGRRRPMLPADGLILTVPLAELDDVRRATARGTELYARLWEIQRTLGFALPVYVVV
TGCEEAPGFAALAEALPPSLTGGMLGWSSPYALETAFSPDFVSEALQSLADGLLAVELEVFGATATPDGA
PLFALTERLTGTEAALRALLGTAFKRTAYQETLYVRGLYFTGRPDPDAAALFGRDLLNRKIFPEAGLPKP
TRALAASRAWRRYSWPVGTGAAALAAILLLWMGVQRASTLSDRLVPVLADIPGGLQQLADQRPAVEAGAP
MTAAYGDPAARFVQGVTMLPTDWTFNPLPASWISGVPDSVSGALAVGYRRLALSTVRDVAEDRLRRLTRD
GGVGPAGVGAFERLRAFAGEIGIAEGLARAYNNVDARDPTLPLDEVLDFALGSGVARGFSARLHGWEIDQ
PPGGTAIPAPGPGAQRPIDLTAHRAEVSRRFRQYADAYLRDLAMGGLAAARLSVAASELELLAGGARSGA
DAAAAYAEVLSSLEDAARGLGAERGAWIGANGPVLPPEFEALLGRLEKSDLLGPNLRADILDLAQRRYDE
AGVSARSLDSVIGRLLEQAPSGGARLAPAAEQLRRTLAVWMARRFMKTDDAGALAMPAVGAGWDRAALDS
IPPLVEDYLLFDAKDLPQAPAMLRTSMRAAAQHQLRQGVERILARALAGSPAGGGVDRAGGLAQLRASAH
ALRTAFPVLAETMQSFRQIGLTTSADTIRDTVARQANAVLAQADRLLEGDQLYRPDAHALDVWVDGPLVP
HLLFGQTTPAGLALYLGNARQEVTVLARDIAAPVVEILERPVMGAGTGSGAASKWARIITELDKYDGGRP
NSSLAQLEKFVTVESAAVDAAGCQNLGAIDGVPDDFFRSRLAELKQWIATRCVLAADARVYDAYVDMAAS
FNEMLAGRFPFAAAAVPGEDADPAAVRAFYERFDARSAFVLEGLRRGERFGTAGREALRFVETMERARPL
LIAAVTPDQSGGLALDPAFRVNRGREAGGSDIIEWKLATPNGALSSVLPRTPLRWYPGDKLSLTLRWAKD
GTVLPVSGVGAGVTVDGPSLRFDYDGPWALFALAGRQAAPQRDRRPGPDTEPLLLFEATASGPVKEAAAA
APMPIVPAVQAVPQPAVKPNVRVFMTLAVKRTVLADGKPPREEKVAVPALPAQAPPLAPVGSMRRMPGLA
GWPAPSGAVAPADRAFFDLGNAPSQPPMLRPAAQRFPVSSSMTTTPHPLIDIGALLQPIPGDDPAGEDLR
HGPEFDALTEARRMDDDLDQGIWQTTVKKADWKGVVQQSSDLLTTRTKDLQVAAWLVQALGHLHGPAGLA
PGLLLVHGLVEDFWEGLYPRLDDGDPEPRLAPLVWLDSQLSRDLMATAITQPGPHTDETHRFQDWQNAQR
LRKLATRDPRAFHAAVDDGEVTVEQILAAQDRTPPDFYQTQHGHLRDTVTAVRTLAAELDAVAGRAAPGF
SQLLKTLESLIQFHREALAKRGIDPDGAAAVTEEAEGGEGATIDASAEIIPAAAFARPGGPRTRQEAYAM
LHQIADFLAREEPHSPTSYLVRRAAAWGNLSLPELYAELLGDRGEVGRIFGLLRLEER
 
Nucleotide Sequence: 4797 bp     [Download]
>gi|392377157|ref|NC_016594.1|:1564684-1569480 Azospirillum brasilense Sp245 plasmid AZOBR_p1, complete sequence
TTGACGATCCCCGCGCCGCCTGGGCCGGCGTGCTCAACCCTGCTGGGCCGCCGCCGCCCGATGCTGCCCG
CCGACGGGCTGATCCTGACCGTGCCGCTGGCCGAGCTGGACGACGTGCGCCGCGCCACCGCGCGCGGGAC
GGAGCTGTACGCCCGGCTGTGGGAGATCCAGCGCACGCTGGGCTTCGCCCTGCCGGTCTATGTGGTGGTG
ACCGGCTGCGAGGAGGCCCCCGGCTTCGCGGCGCTGGCCGAGGCCTTGCCCCCGTCCCTGACCGGTGGGA
TGCTCGGCTGGTCGAGTCCCTACGCTCTGGAGACGGCCTTCTCCCCCGACTTCGTGAGCGAAGCGCTGCA
GTCGCTGGCGGACGGGCTGCTGGCGGTGGAGCTGGAGGTGTTCGGCGCCACGGCCACGCCGGACGGCGCC
CCGCTGTTCGCCCTGACGGAGCGGCTGACCGGGACGGAGGCGGCCTTGCGCGCCCTGCTCGGCACCGCCT
TCAAGCGCACCGCCTATCAGGAAACGCTCTACGTCCGCGGCCTCTACTTCACGGGCCGCCCCGATCCCGA
CGCGGCGGCGCTGTTCGGGCGCGACCTGCTGAACCGCAAGATCTTCCCCGAGGCCGGCCTGCCCAAGCCG
ACCCGCGCGCTGGCCGCCTCCCGCGCGTGGCGCCGCTATTCCTGGCCGGTGGGGACGGGGGCCGCCGCGC
TGGCCGCGATTCTGCTGCTGTGGATGGGGGTGCAGCGCGCCTCCACCCTGTCGGACCGGCTGGTTCCGGT
CCTGGCCGATATTCCGGGCGGGCTGCAGCAGCTCGCCGACCAGCGCCCGGCGGTCGAGGCCGGGGCGCCG
ATGACCGCCGCCTACGGCGATCCGGCCGCCCGCTTCGTGCAGGGCGTGACCATGCTGCCCACCGACTGGA
CCTTCAACCCTCTGCCGGCCTCCTGGATCAGCGGCGTTCCGGATTCGGTGTCGGGGGCGCTGGCCGTCGG
CTACCGCCGGCTGGCCCTGTCCACCGTGCGCGACGTTGCCGAGGACCGGCTGCGCCGCCTGACCCGCGAT
GGCGGGGTGGGGCCGGCGGGGGTGGGCGCCTTCGAGCGGCTGCGCGCCTTCGCGGGCGAGATCGGCATCG
CCGAGGGGCTGGCCCGCGCCTACAACAACGTGGACGCCCGCGACCCGACCCTGCCGCTGGACGAGGTGCT
GGACTTCGCGCTGGGCTCCGGCGTGGCGCGCGGTTTTTCCGCGCGGCTGCACGGCTGGGAGATCGACCAG
CCGCCGGGCGGCACCGCCATCCCGGCGCCGGGACCAGGGGCGCAACGCCCCATCGACCTGACCGCCCACC
GGGCGGAGGTCAGCCGCCGTTTCCGGCAGTACGCCGACGCCTATCTGCGCGACCTCGCCATGGGCGGCCT
CGCCGCCGCGCGGCTGTCGGTCGCCGCCAGCGAGCTGGAGCTGCTGGCTGGCGGGGCGCGCTCCGGCGCC
GACGCGGCGGCGGCCTACGCCGAGGTGCTGTCGAGCCTGGAGGACGCCGCCCGCGGCCTGGGGGCGGAGC
GCGGCGCCTGGATCGGCGCCAACGGCCCCGTCCTGCCGCCGGAGTTCGAGGCGCTGCTGGGCCGGCTGGA
GAAGTCCGACCTGCTCGGCCCCAACCTGCGCGCCGACATCCTGGATCTGGCGCAGCGCCGCTACGACGAG
GCGGGGGTGAGCGCGCGCAGTCTGGACTCGGTGATCGGCCGCCTGCTGGAACAGGCCCCCAGCGGAGGCG
CCCGCTTGGCTCCGGCGGCGGAGCAGCTTCGCCGCACCCTGGCGGTGTGGATGGCCCGCCGCTTCATGAA
GACGGACGACGCCGGCGCGCTGGCGATGCCCGCCGTGGGCGCCGGCTGGGACCGCGCCGCTCTGGACAGC
ATCCCGCCGCTGGTCGAGGACTATCTGCTGTTCGACGCCAAGGACCTGCCGCAGGCGCCGGCCATGCTCC
GCACCTCCATGCGGGCGGCGGCGCAGCACCAGCTCCGCCAAGGGGTGGAGCGCATCCTCGCCCGCGCTTT
GGCCGGCAGCCCGGCAGGCGGCGGGGTGGACCGGGCGGGTGGGCTGGCGCAGCTCCGCGCCTCGGCCCAC
GCGTTGCGCACCGCTTTCCCGGTGCTGGCCGAGACCATGCAGTCCTTCCGCCAGATCGGGCTGACCACCT
CCGCCGACACCATCCGCGACACGGTGGCCCGGCAGGCCAACGCTGTGCTGGCCCAGGCCGACCGGCTGCT
GGAGGGCGACCAGCTCTACCGGCCCGACGCCCACGCGCTGGACGTCTGGGTGGACGGGCCGCTGGTGCCG
CACCTGCTGTTCGGGCAGACCACGCCGGCCGGGCTGGCGCTCTATCTCGGCAACGCCCGGCAGGAGGTGA
CGGTGCTCGCCCGCGACATCGCCGCCCCGGTGGTGGAAATCCTGGAGCGCCCGGTGATGGGCGCCGGGAC
CGGGTCTGGCGCCGCCTCCAAGTGGGCGCGCATCATCACCGAGCTGGACAAGTACGACGGCGGGCGCCCG
AACAGCTCCCTGGCGCAGCTGGAAAAGTTCGTGACGGTGGAAAGCGCCGCGGTGGACGCCGCCGGTTGCC
AGAATCTCGGCGCCATCGACGGGGTGCCGGACGACTTCTTCCGCAGCCGTCTCGCCGAGCTGAAGCAGTG
GATCGCCACGCGCTGCGTGCTGGCCGCCGACGCCCGCGTCTACGACGCCTACGTCGACATGGCCGCGTCC
TTCAACGAGATGCTGGCCGGCCGCTTCCCCTTCGCCGCCGCCGCGGTGCCGGGCGAGGACGCCGACCCGG
CGGCGGTGCGCGCCTTCTACGAGCGGTTCGACGCGCGGTCGGCCTTCGTGCTGGAGGGCTTGCGCCGCGG
CGAACGCTTCGGCACCGCCGGGCGCGAGGCGCTGCGCTTCGTGGAGACGATGGAGCGGGCGCGTCCGCTG
CTGATCGCCGCGGTGACCCCGGACCAGAGCGGCGGCTTGGCGCTCGACCCCGCCTTCCGTGTCAACCGCG
GCCGCGAGGCCGGGGGCAGCGACATCATCGAATGGAAGCTCGCCACGCCGAACGGCGCCCTGTCCAGCGT
GCTGCCGCGGACGCCGTTGCGCTGGTACCCTGGCGACAAGCTGAGCCTGACGCTGCGCTGGGCCAAGGAT
GGCACGGTGCTGCCGGTGTCCGGCGTCGGTGCGGGGGTGACGGTGGACGGCCCCTCGCTGCGCTTCGACT
ATGACGGTCCCTGGGCGCTGTTCGCCCTGGCCGGCCGGCAGGCCGCGCCTCAACGCGACCGCCGCCCCGG
CCCGGACACCGAGCCGCTGCTGCTGTTCGAGGCCACGGCCAGCGGCCCAGTCAAGGAAGCCGCCGCCGCT
GCCCCGATGCCGATCGTTCCGGCGGTGCAGGCGGTGCCGCAACCCGCGGTGAAGCCCAACGTGCGGGTCT
TCATGACTCTGGCGGTCAAGCGCACCGTCTTGGCCGACGGCAAGCCGCCGCGCGAGGAGAAGGTGGCCGT
GCCGGCGCTGCCCGCGCAGGCGCCGCCGCTCGCCCCGGTCGGCTCCATGCGGCGGATGCCCGGCTTGGCC
GGATGGCCGGCGCCCTCCGGGGCGGTGGCTCCGGCGGATCGCGCCTTCTTCGATCTGGGCAACGCCCCGT
CCCAGCCCCCGATGCTCCGCCCCGCGGCCCAACGCTTTCCCGTGAGCAGTTCCATGACCACCACGCCCCA
CCCTCTGATCGACATCGGTGCCCTGCTCCAGCCCATCCCCGGCGACGATCCGGCGGGCGAGGACCTGCGC
CATGGCCCGGAATTCGACGCGCTGACCGAGGCGCGCCGGATGGACGACGATCTGGACCAGGGCATCTGGC
AGACCACCGTCAAGAAGGCCGACTGGAAGGGCGTCGTCCAGCAGTCCTCGGACCTGCTGACGACCCGCAC
CAAGGATCTTCAGGTCGCGGCGTGGCTGGTCCAGGCGCTGGGCCACCTGCACGGCCCGGCGGGGCTGGCG
CCGGGGCTTCTGCTGGTCCATGGGCTGGTCGAGGATTTCTGGGAGGGCCTCTATCCGCGCCTGGACGACG
GCGATCCGGAGCCGCGGCTGGCGCCGCTGGTCTGGCTGGACAGCCAGTTGTCGCGCGACCTGATGGCGAC
CGCCATCACCCAGCCGGGACCGCACACCGACGAGACGCACCGTTTCCAGGATTGGCAGAACGCCCAGCGC
CTGCGCAAGCTCGCCACCCGCGATCCGCGCGCCTTCCACGCGGCGGTCGATGACGGCGAGGTGACGGTTG
AGCAGATCCTCGCCGCCCAGGACCGCACGCCGCCGGACTTCTACCAGACCCAGCACGGTCATCTGCGCGA
CACGGTGACGGCGGTGCGCACCCTGGCGGCGGAACTGGACGCCGTGGCCGGCCGCGCCGCCCCCGGCTTC
AGCCAGCTGCTGAAGACCCTGGAAAGCCTGATCCAGTTCCACCGCGAGGCGCTCGCCAAGCGCGGCATCG
ATCCGGACGGCGCCGCCGCCGTGACGGAGGAGGCCGAGGGCGGGGAGGGAGCTACCATCGACGCGTCCGC
CGAGATCATCCCCGCCGCCGCCTTCGCCCGCCCCGGCGGGCCGCGGACCCGGCAGGAGGCCTACGCGATG
CTGCACCAGATTGCCGATTTCCTGGCGCGGGAGGAGCCGCACAGCCCGACCTCCTACCTCGTCCGCCGCG
CCGCCGCCTGGGGGAACCTGTCCCTGCCGGAGCTGTACGCCGAGCTGCTGGGCGACCGCGGCGAGGTCGG
GCGGATCTTCGGACTTCTGCGGCTTGAGGAGCGCTGA
 Primer design