SecReT6
Protein ID: 392378703
SecReT6 ID519
T6SS typei4a
Gene symbol-
Locus tagAZOBR_p1150012
StrainAzospirillum brasilense Sp245
Repliconplasmid AZOBR_p1 [GenBank: NC_016594] [Browse all T6SS(s) in this replicon]
Location [Strand]1569484..1570041 [+]
Producthypothetical protein
NoteTssD
UniProt IDG8APG1
KEGG IDabs:AZOBR_p1150012
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.30E-14, Aligned region: 49..164
Protein Sequence: 185 a.a.     [Download]
>gi|392378703|ref|YP_004985863.1| conserved protein of unknown function [Azospirillum brasilense Sp245]
MPRILLDYPGIKGESLIRNYKNLADCVSFDLSSGKREVGGFNYDDPIEETSYFSGRKAQKQDKLGVDSLK
LERHFDLASPKLMQAAFDPQKKDVTATIHFFRTFAQLQGGEHFGESDIFAEPYLTIILKNTQITEYVLSV
DDDDSSNGTETISLAFDQLQMTYQHQIDGRKIGQIRGDITLASKS
 
Nucleotide Sequence: 558 bp     [Download]
>gi|392377157|ref|NC_016594.1|:1569484-1570041 Azospirillum brasilense Sp245 plasmid AZOBR_p1, complete sequence
ATGCCCCGCATCCTGCTTGACTATCCCGGCATCAAGGGCGAGTCGCTGATCCGCAACTACAAGAATCTGG
CCGACTGCGTCAGCTTCGACCTGTCTTCGGGCAAGCGCGAGGTCGGCGGCTTCAACTACGACGACCCGAT
CGAGGAGACCTCCTATTTCAGCGGCCGGAAGGCGCAGAAGCAGGACAAGCTCGGCGTCGACAGCCTGAAG
CTGGAGCGCCACTTCGACCTCGCCTCGCCCAAGCTGATGCAGGCGGCCTTCGATCCGCAGAAGAAGGACG
TCACCGCGACGATCCACTTCTTCCGCACCTTCGCGCAGTTGCAGGGCGGCGAGCATTTCGGCGAAAGCGA
CATCTTCGCCGAGCCGTACCTGACCATCATCCTGAAGAACACGCAGATCACCGAATACGTGCTGTCGGTT
GACGACGACGACAGCAGCAACGGCACCGAGACCATCTCGCTGGCCTTCGACCAGTTGCAGATGACCTACC
AGCACCAGATCGACGGCCGGAAAATCGGCCAAATCCGTGGCGACATCACATTGGCGAGCAAGTCATGA
 Primer design