SecReT6
Protein ID: 392419218
SecReT6 ID671
T6SS typei1
Gene symbol-
Locus tagA458_00655
StrainPseudomonas stutzeri CCUG 29243
Repliconchromosome [GenBank: NC_018028] [Browse all T6SS(s) in this replicon]
Location [Strand]129742..131250 [-]
ProductFis family transcriptional regulator
NoteSfa2
UniProt IDI4CMU2
KEGG IDpsc:A458_00655
PDB IDNA
Domain hit(s) vs Pfam Sigma54_activat [PF00158], Evalue: 1.10E-70, Aligned region: 196..363
Sigma54_activ_2 [PF14532], Evalue: 1.20E-24, Aligned region: 197..367
HTH_8 [PF02954], Evalue: 2.00E-14, Aligned region: 455..495
AAA_5 [PF07728], Evalue: 1.00E-07, Aligned region: 219..338
GAF_2 [PF13185], Evalue: 8.30E-06, Aligned region: 26..174
GAF_2 [PF13185], Evalue: 8.30E-06, Aligned region: 259..280
HTH_30 [PF13556], Evalue: 9.10E-06, Aligned region: 451..465
HTH_30 [PF13556], Evalue: 9.10E-06, Aligned region: 469..495
GAF_3 [PF13492], Evalue: 3.60E-05, Aligned region: 28..150
HTH_28 [PF13518], Evalue: 0.003, Aligned region: 469..492
AAA_2 [PF07724], Evalue: 0.0055, Aligned region: 218..318
AAA [PF00004], Evalue: 0.0073, Aligned region: 220..353
Protein Sequence: 502 a.a.     [Download]
>gi|392419218|ref|YP_006455822.1| Fis family transcriptional regulator [Pseudomonas stutzeri CCUG 29243]
MFNQVPQPLRYAEALLGRFAGLARAANADSLLGGLVETAAQLSDCQLSQLYLLDATHTRLTLSAEWHNGL
LQPREATSLPSDYDGEQLLQYCLCQNQTLCLSELDSSLHASGFLPDSPKPWLSLLCLPLQDEQQRVAGLL
LTASTESRELQGFSGSLAQLGAFGLAQLHLLQRLRAPGSTTPPAAPVSPCASGYGLIGDSPRMRAVYQLI
GKVLHSPVNVLLTGETGTGKELVARAIHDCGFRRSKPFIVQNCASLPEQLLESELFGYRKGAFTGADRDR
SGLLDAANGGTLFLDEIGDMPLLLQAKLLRVLQEGEVRPLGSTETHKVDVRVVAATHRDLRSQVENGLFR
EDLFYRLSHFPIELPPLRERDEDILRLARHFADKACAFLQRDLCRWSDAALERLAGYAFPGNVRELKGLV
ERAVLLCEGGELLPEHFNLHVEASLDSSLNLRERMERVERSLLMDCLRKNGGNQSQAARELGLPRRTLLY
RMERLNISPADL
 
Nucleotide Sequence: 1509 bp     [Download]
>gi|392419087|ref|NC_018028.1|:c131250-129742 Pseudomonas stutzeri CCUG 29243 chromosome, complete genome
ATGTTCAATCAGGTGCCACAGCCGCTGCGCTATGCCGAAGCACTGCTCGGTCGCTTCGCCGGGCTGGCGC
GCGCGGCGAACGCCGACAGCCTGCTCGGTGGGCTGGTGGAAACCGCGGCGCAGCTGAGCGACTGCCAGCT
CAGCCAGCTCTATCTGCTGGACGCCACCCATACCCGCCTGACGCTCTCGGCCGAGTGGCACAACGGCCTG
TTGCAGCCACGCGAAGCCACCAGTCTGCCGAGCGATTATGACGGTGAGCAGCTGCTGCAATACTGCCTGT
GCCAGAACCAAACCCTCTGTCTCAGCGAACTGGACAGCAGCCTGCATGCTTCGGGTTTCCTGCCGGATAG
CCCGAAACCGTGGCTTAGCCTGCTCTGCCTGCCGCTGCAGGACGAGCAACAGCGCGTCGCCGGCCTGCTG
CTCACGGCCAGTACCGAGTCGCGCGAGCTGCAAGGCTTCAGCGGTTCGCTGGCCCAGCTTGGCGCCTTCG
GCCTCGCCCAGCTGCATCTGCTCCAACGCCTGCGCGCGCCCGGCAGCACCACGCCACCTGCCGCGCCAGT
CAGCCCCTGCGCCAGCGGTTACGGCCTGATCGGCGACAGCCCGCGCATGCGCGCGGTCTACCAGTTGATC
GGCAAGGTGCTGCACAGCCCGGTCAACGTGCTGCTCACGGGAGAAACCGGCACCGGCAAGGAACTGGTGG
CGCGCGCCATCCATGACTGCGGTTTCCGCCGTAGCAAGCCCTTCATCGTGCAGAACTGCGCTTCGCTGCC
AGAGCAGCTCTTGGAAAGTGAGCTGTTCGGCTACCGCAAGGGCGCCTTCACCGGCGCCGACCGCGACCGC
AGCGGCCTGCTCGATGCGGCGAACGGCGGCACGCTATTCCTCGACGAGATCGGTGACATGCCGCTGCTGC
TGCAAGCCAAGCTGTTGCGCGTCCTGCAGGAAGGCGAAGTGCGCCCGCTGGGCTCCACCGAGACCCACAA
GGTCGACGTGCGCGTCGTTGCCGCCACCCACCGTGACCTGCGCAGCCAGGTGGAGAACGGCCTGTTTCGC
GAGGATCTTTTCTACCGCCTCTCGCACTTCCCCATCGAGCTGCCGCCTCTGCGCGAGCGCGACGAGGACA
TCCTGCGCCTGGCACGGCACTTCGCCGACAAGGCCTGCGCCTTCCTGCAGCGCGATCTGTGTCGCTGGTC
CGACGCTGCGCTCGAACGTCTGGCAGGCTATGCCTTCCCCGGAAACGTGCGGGAATTGAAAGGTCTGGTG
GAGCGCGCCGTGCTGCTTTGCGAGGGCGGTGAGCTGCTGCCGGAACACTTCAACCTGCATGTCGAAGCGA
GCCTGGACAGCAGCCTGAACCTGCGCGAGCGCATGGAGCGGGTCGAACGCAGCCTGCTCATGGATTGCCT
GCGCAAGAACGGCGGCAACCAGAGCCAGGCGGCCCGCGAACTAGGCCTGCCACGGCGCACGCTGCTGTAT
CGCATGGAACGGCTGAATATCAGCCCGGCCGATCTCTAA
 Primer design