SecReT6
Protein ID: 392423211
SecReT6 ID672
T6SS typeN/A
Gene symbol-
Locus tagA458_20885
StrainPseudomonas stutzeri CCUG 29243
Repliconchromosome [GenBank: NC_018028] [Browse all T6SS(s) in this replicon]
Location [Strand]4500773..4501969 [+]
ProductFHA domain-containing protein
NoteFha
UniProt IDI4CZ85
KEGG IDpsc:A458_20885
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 2.10E-12, Aligned region: 29..97
Protein Sequence: 398 a.a.     [Download]
>gi|392423211|ref|YP_006459815.1| FHA domain-containing protein [Pseudomonas stutzeri CCUG 29243]
MELVFDMVGAQQFVPGLLTTKTFKQAGGVIGRAEGCDWVIPDRKRVLSGRHAVISYRDGAFFLTDTSSNG
IQLKDSGASLVKGQPQRIEHGSVYCLGDFEIRARLIQDPALFEGDIGRPQPAGSIIPDDAFLDLDPLVAM
DQQERVYAEVDDLDLALVAPQRQAQQRDYARIDMESLPLPELVMPQAAPEAKREAEPERLPQGFWARFGE
ALGIDLDDLDEEQRQALALNAARLLKQSVGGLQQSLRTRSELKNELRLALTTVQSAGNNPLKHSADTGEA
VSALLRGGKPGQLTAEQAIGRAFRDLQAHQVALLAASRAAVHAMFEQLAPEQLALRFEREGRKPLIATAG
SRWRAYRRLHHSLGQDADWSERLFARDFAKTYEEQVRLIATLDSTHQG
 
Nucleotide Sequence: 1197 bp     [Download]
>gi|392419087|ref|NC_018028.1|:4500773-4501969 Pseudomonas stutzeri CCUG 29243 chromosome, complete genome
ATGGAACTGGTCTTCGATATGGTGGGTGCCCAGCAATTCGTGCCGGGGCTGCTGACCACCAAAACCTTCA
AGCAGGCCGGCGGCGTGATCGGCCGGGCCGAAGGCTGCGATTGGGTGATCCCGGATCGCAAGCGCGTCCT
CTCCGGGCGTCACGCGGTGATCAGCTACCGCGACGGCGCCTTCTTCCTTACCGACACCAGCAGCAACGGC
ATCCAGCTCAAGGACAGTGGCGCCAGCCTGGTCAAGGGCCAGCCGCAGCGCATCGAGCATGGCAGCGTCT
ACTGCCTGGGCGACTTCGAGATCCGCGCCCGGCTGATTCAGGACCCGGCGCTGTTCGAAGGCGACATCGG
CCGCCCGCAGCCGGCCGGCAGCATCATCCCCGACGACGCTTTTCTCGACCTCGATCCGCTGGTTGCCATG
GATCAGCAGGAGCGCGTCTATGCCGAGGTAGACGACCTCGACCTCGCCCTGGTAGCGCCACAGCGCCAGG
CGCAGCAGCGCGACTACGCGCGCATCGACATGGAAAGCCTGCCGTTGCCGGAGCTGGTCATGCCTCAGGC
AGCGCCGGAAGCCAAGCGCGAAGCCGAGCCCGAACGACTGCCGCAGGGATTCTGGGCGCGTTTCGGCGAG
GCGCTGGGCATCGATCTCGACGATCTCGACGAGGAACAGCGCCAGGCCCTGGCGTTGAACGCCGCCCGCC
TGCTCAAGCAGAGCGTCGGCGGCCTGCAGCAGAGCCTACGCACCCGCAGCGAGCTGAAGAACGAGTTGCG
CCTGGCGTTGACCACTGTGCAGAGCGCTGGCAACAACCCACTCAAGCACAGTGCCGATACGGGTGAGGCC
GTGAGCGCCCTGCTGCGAGGTGGCAAGCCCGGCCAGCTTACGGCTGAACAGGCCATCGGACGCGCCTTCC
GCGACCTGCAGGCGCATCAGGTGGCACTGCTAGCGGCCAGCCGCGCCGCCGTTCACGCCATGTTCGAACA
GCTCGCGCCGGAGCAGCTGGCACTGCGTTTCGAACGCGAGGGCCGCAAGCCGCTGATCGCCACCGCCGGC
AGTCGCTGGCGCGCCTACCGCCGGTTGCATCACAGCCTCGGCCAGGACGCCGACTGGAGCGAACGGCTGT
TCGCCCGCGACTTCGCCAAGACCTATGAGGAGCAGGTGCGCCTGATCGCCACGCTCGATTCAACCCATCA
AGGATGA
 Primer design