SecReT6
Protein ID: 392423212
SecReT6 ID672
T6SS typeN/A
Gene symbol-
Locus tagA458_20890
StrainPseudomonas stutzeri CCUG 29243
Repliconchromosome [GenBank: NC_018028] [Browse all T6SS(s) in this replicon]
Location [Strand]4501974..4502456 [+]
Producthypothetical protein
NoteTssJ
UniProt IDI4CZ86
KEGG IDpsc:A458_20890
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 2.60E-40, Aligned region: 13..149
Protein Sequence: 160 a.a.     [Download]
>gi|392423212|ref|YP_006459816.1| hypothetical protein A458_20890 [Pseudomonas stutzeri CCUG 29243]
MPRRITLAMLASLLVLGGCSALSPYSKLTKLDLELHGSDRLNPDLNGRPSPIVLRLLELKHPVAFENGDF
FALYQRPKEALAPDLVTSEELELRPGESRELKLSVQEGSRYVGVLAAYRDLPEASWRYVIAVPPQERTRV
ALSLDERGIALFDPLAEEGK
 
Nucleotide Sequence: 483 bp     [Download]
>gi|392419087|ref|NC_018028.1|:4501974-4502456 Pseudomonas stutzeri CCUG 29243 chromosome, complete genome
ATGCCTCGTCGCATCACCCTGGCCATGCTGGCCTCGCTGCTCGTGCTGGGCGGCTGCTCGGCGCTGTCGC
CGTACTCCAAGCTGACCAAGCTCGACCTCGAACTGCACGGCAGCGACCGTCTCAATCCCGACCTCAACGG
CCGGCCGTCGCCGATCGTGCTGCGCCTGCTGGAGCTCAAGCATCCGGTGGCGTTCGAAAACGGCGACTTC
TTCGCCCTCTACCAGCGGCCCAAGGAAGCCCTGGCGCCAGACCTGGTGACCTCCGAGGAACTGGAACTGC
GTCCCGGCGAAAGCCGCGAGTTGAAGCTATCGGTGCAGGAAGGCAGCCGCTATGTCGGCGTGTTGGCCGC
CTACCGCGACCTGCCGGAAGCCAGCTGGCGCTACGTCATCGCCGTGCCGCCGCAAGAGCGCACCCGTGTC
GCCCTAAGCCTGGATGAGCGCGGCATCGCGCTGTTCGACCCGCTCGCCGAAGAAGGAAAATAA
 Primer design