SecReT6
Protein ID: 392423213
SecReT6 ID672
T6SS typeN/A
Gene symbol-
Locus tagA458_20895
StrainPseudomonas stutzeri CCUG 29243
Repliconchromosome [GenBank: NC_018028] [Browse all T6SS(s) in this replicon]
Location [Strand]4502459..4503790 [+]
Producthypothetical protein
NoteTssK
UniProt IDI4CZ87
KEGG IDpsc:A458_20895
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.50E-145, Aligned region: 18..442
Protein Sequence: 443 a.a.     [Download]
>gi|392423213|ref|YP_006459817.1| hypothetical protein A458_20895 [Pseudomonas stutzeri CCUG 29243]
MSLHKVVWQEGMLLRPQHFQQNDRYYDHQLKARTQKLGSYAWGFFNLEIDRQFLNMGKLVLSQASGILLD
GTLFELGSEREPLALDIPPNTGSTPVYLALPLVTGNHIETRRPEQKDVLARYTAHELDVADSNAGDSSTS
QVSTGLPDFRLLLGEQQSDQAYVKLQLCEVLDTTPDGVISLDPEFIPTYVNFQASGYLLSCLKEVISMLA
HRGDALAERISATGKVGGAEVGDFMMLQLINRHEPVLRHYLGVEKVHPEQIYRDLLGLLGELATFSSESK
RPRLEGRYQHSDQGASFRKLMDAIRQVLSMVLEQHAIELLLQQRQYGIQVSPLHDHKLLGTASFVLAASA
QCDSETLRTRLPAHLKIGPVERIRQLVNLHLPGIRIKPLPVAPRQIPFHAGKTYFALELNAEDQAQLERS
GGFAFHVSGDFAGLELKFWAVRD
 
Nucleotide Sequence: 1332 bp     [Download]
>gi|392419087|ref|NC_018028.1|:4502459-4503790 Pseudomonas stutzeri CCUG 29243 chromosome, complete genome
ATGAGCCTGCACAAGGTTGTCTGGCAGGAAGGCATGCTGCTGCGTCCGCAACACTTCCAGCAGAACGATC
GCTACTACGATCACCAACTCAAGGCGCGCACCCAGAAGCTGGGCAGCTATGCCTGGGGTTTCTTCAACTT
GGAGATCGACCGCCAGTTCCTCAACATGGGCAAGCTGGTGCTCAGCCAGGCCAGCGGCATCCTGTTGGAT
GGCACGCTGTTCGAGCTGGGCAGCGAGCGCGAGCCACTGGCGCTGGACATTCCGCCGAACACCGGCAGTA
CACCGGTATACCTCGCGCTGCCACTGGTCACCGGCAACCACATCGAAACGCGTCGCCCCGAACAGAAGGA
CGTGCTGGCGCGCTACACCGCCCATGAGCTGGATGTCGCCGACTCCAATGCCGGCGACAGCAGCACCAGC
CAGGTCAGCACCGGGCTGCCGGATTTCCGCCTGCTGCTGGGCGAGCAGCAGAGCGACCAGGCCTACGTGA
AACTGCAGCTGTGCGAGGTGCTGGACACCACGCCGGACGGGGTCATCAGCCTCGATCCCGAGTTCATTCC
CACCTACGTCAACTTCCAGGCCTCAGGCTATCTGCTGTCCTGCCTGAAGGAAGTGATCAGCATGCTCGCC
CACCGCGGCGATGCCCTCGCCGAGCGCATCAGCGCCACCGGCAAGGTCGGTGGCGCCGAGGTCGGCGACT
TCATGATGCTGCAGCTGATCAACCGTCACGAACCGGTGCTGCGCCACTACCTGGGCGTGGAGAAGGTGCA
CCCGGAGCAGATCTACCGCGACCTGCTTGGCCTGCTCGGCGAGCTGGCGACCTTCTCCAGCGAGAGCAAG
CGCCCACGCCTGGAGGGTCGTTACCAGCACAGTGACCAGGGCGCGAGCTTCCGCAAGCTGATGGACGCGA
TCCGCCAGGTGCTGTCGATGGTGCTCGAACAGCACGCCATTGAACTGCTGCTGCAGCAGCGCCAGTACGG
CATCCAGGTATCGCCACTGCACGATCACAAGCTGCTCGGCACGGCGTCCTTCGTGCTCGCCGCCAGCGCC
CAGTGCGATTCGGAAACCCTGCGCACCCGCCTGCCGGCGCACCTGAAGATCGGCCCGGTGGAGCGCATCC
GCCAGCTGGTCAACCTGCATCTGCCGGGCATCCGCATCAAGCCGCTGCCGGTGGCGCCGCGGCAGATCCC
CTTCCATGCAGGCAAGACCTATTTCGCGCTGGAACTCAACGCCGAGGACCAGGCGCAGCTGGAGCGCTCC
GGCGGCTTTGCCTTCCATGTGTCCGGTGACTTCGCCGGGCTCGAACTGAAATTCTGGGCGGTCAGGGACT
GA
 Primer design