SecReT6
Protein ID: 392423214
SecReT6 ID672
T6SS typeN/A
Gene symbol-
Locus tagA458_20900
StrainPseudomonas stutzeri CCUG 29243
Repliconchromosome [GenBank: NC_018028] [Browse all T6SS(s) in this replicon]
Location [Strand]4503796..4504677 [+]
Productputative outer membrane protein
NoteTssL
UniProt IDI4CZ88
KEGG IDpsc:A458_20900
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 2.30E-72, Aligned region: 61..266
Protein Sequence: 293 a.a.     [Download]
>gi|392423214|ref|YP_006459818.1| putative outer membrane protein [Pseudomonas stutzeri CCUG 29243]
MIKEMDYGQNDHTVIVNRAGEAPAQSPLTDFDTPPRFEQLEERMIYAARLRPAETFNISLNPLVAAASPL
LSEVVRLKHSLDSEDLQALHRQLSSAIKLFEHRALHDGAESSQVMAARYVLCTILDEAVVTTPWGNESEW
SQMSLLSSFHNETFGGEKFFQLLERLSRNPVKHLPMLELMYLCLSLGFEGKYRVLPRGMLELEAVRDSLY
RQIRQMRGDIPRELSPHWEGLKDTRRRLVRIVPWWMVALFTLMCLGVIYSGFAWVLGEQRESVLQPYRSL
DMDAGDSTFSGMK
 
Nucleotide Sequence: 882 bp     [Download]
>gi|392419087|ref|NC_018028.1|:4503796-4504677 Pseudomonas stutzeri CCUG 29243 chromosome, complete genome
ATGATCAAGGAAATGGATTACGGACAGAACGACCACACGGTCATCGTCAACCGCGCCGGCGAGGCCCCGG
CACAGAGCCCGTTGACCGACTTCGACACCCCGCCGCGCTTCGAGCAGCTGGAGGAGCGGATGATCTACGC
CGCCCGCCTGCGCCCGGCGGAAACCTTCAACATCAGTCTCAATCCGCTGGTGGCCGCCGCCTCGCCGCTG
CTCTCGGAAGTGGTACGGCTCAAGCACAGCCTGGACAGCGAAGACCTGCAGGCACTGCACCGGCAATTGA
GCAGCGCGATCAAGCTGTTCGAGCACCGCGCCCTGCACGACGGCGCCGAGAGCAGTCAGGTGATGGCGGC
GCGCTACGTGCTCTGCACCATTCTCGACGAGGCCGTAGTGACCACGCCCTGGGGCAACGAGAGCGAATGG
TCGCAGATGAGCCTGCTGTCCTCCTTCCACAACGAAACCTTCGGCGGCGAGAAGTTCTTCCAGCTGCTCG
AGCGGCTATCGCGCAACCCGGTCAAGCACCTGCCGATGCTCGAACTGATGTACCTGTGTCTGTCCCTCGG
CTTCGAGGGCAAGTACCGCGTGTTGCCGCGCGGCATGCTTGAGCTGGAAGCGGTGCGCGACAGCCTCTAC
CGGCAGATCAGGCAGATGCGTGGCGACATACCGCGCGAGCTGTCGCCGCACTGGGAGGGCCTCAAGGACA
CCCGCCGGCGCCTGGTGCGCATCGTGCCCTGGTGGATGGTCGCGCTGTTCACCCTGATGTGCCTCGGGGT
GATCTACAGCGGTTTCGCCTGGGTGCTCGGCGAACAACGCGAGAGCGTGCTGCAACCCTATCGCTCGCTG
GACATGGATGCCGGCGATTCCACCTTTTCAGGGATGAAATGA
 Primer design