SecReT6
Protein ID: 392423215
SecReT6 ID672
T6SS typeN/A
Gene symbol-
Locus tagA458_20905
StrainPseudomonas stutzeri CCUG 29243
Repliconchromosome [GenBank: NC_018028] [Browse all T6SS(s) in this replicon]
Location [Strand]4504679..4508218 [+]
Producttype VI secretion protein IcmF
NoteTssM
UniProt IDI4CZ89
KEGG IDpsc:A458_20905
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 1.20E-77, Aligned region: 502..793
ImcF-related_N [PF14331], Evalue: 4.60E-73, Aligned region: 197..453
DUF1215 [PF06744], Evalue: 1.30E-37, Aligned region: 76..96
DUF1215 [PF06744], Evalue: 1.30E-37, Aligned region: 914..1038
AAA_33 [PF13671], Evalue: 0.00016, Aligned region: 135..267
DUF4131 [PF13567], Evalue: 0.0013, Aligned region: 15..112
DUF4131 [PF13567], Evalue: 0.0013, Aligned region: 450..473
Protein Sequence: 1179 a.a.     [Download]
>gi|392423215|ref|YP_006459819.1| type VI secretion protein IcmF [Pseudomonas stutzeri CCUG 29243]
MKTFFGKLGAVLRRTWVWSLLLVLLLAVLVWFVGPLLAVNDHRFWESSSSRLLSISVLFLGWGLAMVFAS
WRASARKKRDAEDQDMQEQLRRDGLIGEEQQELRHRFKQALRTLKTSSLYRGRSEKWRSELPWYLLIGPQ
GSGKTSLLDFSGLDFPLNRSEQQRLTKDVSGTRYADWYFADHAVLIDTAGRYLTQPDAAVDGSAWDTLLG
LLRKRRARPLNGVLVNLPVDQLLGGNELELENLARQARQRLHEIHQRLGVDVPVYLVLSKADRILGFDEF
FDQLSREESDQVLGASFRKEQNGSDAQVVREEFEELLRRLNSQVIMRMHQERDSQRRGRILDFPHQLGQI
GERLSLFIELAFAGNRYQRASQLRGFYLTSAPQLREGLDPLTAGIGRQFGLASSALPTFRSGRARFINQL
LSRVIFPEAELAGLDQREVRRIDWGQRALYAGAFGCLVLFGGAWALNFSSNHERLEQLRGIAQTLGGERK
TIEVEDEALRTLKVLDGSYAATQVFPPRDDVSWLRRGGLYQGEAVDPTLHDAYRRDLETLLLPRVGRQLE
AQIRANLNDREQLLGSLRAYLMLNLAERRDAAFLKDWLAADWSLRHSGNAVAQQGLNTHFARLLEESFAP
YQLNDNLVAKARAQLRSESLAAVVYRMLRDQARNLPDYRLNTQLGPQASLFVGGNYAIPGFYTQRGYQKL
FAAQGAELVSEILRDNWVLGEGDSLSAKDLGRLLVEMEQLYFRDYATHWSEAITQLNVLPAGSAAQGAAQ
LAGLTAANSPLLQLLLAVRENTRFAGLADATAEAGELADTAQNAGGKLGKAAKLATAAAEQAQAALLKNV
PDTARKTLERRFAPLHQLLDENGAAGPELTASLQALDALQLQLASLAHASAPEQAAFEMAKARMGGQRDA
INQLRSSASRLPQPVGKWLGLLAEDSWSLVLSDAYHYLNQRYRNELYASYRGSLRERYPFSAHSASDVAL
ADFREFFKAQGLADSFFERYLKPFVSGSAGQYQLRRVDGRGLPLSEQFLAQMSRAQTIRRSFFAENPNEP
QILFKLEPYSLDSSLGRADFRFGNQQMEYRHGPIVQTAFRWPAEADDGRTSLVVEELGGRRVGIEKNTGP
WSLFRLIDLMQVDYHSGRDVLMLKADLGGLRANYLLHAQRSPNPFDLALLRGFKLPATL
 
Nucleotide Sequence: 3540 bp     [Download]
>gi|392419087|ref|NC_018028.1|:4504679-4508218 Pseudomonas stutzeri CCUG 29243 chromosome, complete genome
ATGAAGACGTTCTTCGGCAAACTCGGCGCCGTGCTGCGCCGAACCTGGGTCTGGAGCCTGCTGCTGGTCC
TGCTGCTAGCGGTTCTGGTGTGGTTCGTCGGGCCGCTGCTGGCGGTGAATGACCACCGCTTCTGGGAGTC
ATCCAGCAGCCGTCTGCTGAGCATCAGCGTCCTGTTCCTCGGCTGGGGCCTGGCCATGGTCTTCGCCAGC
TGGCGCGCCAGCGCGCGCAAGAAGCGCGATGCCGAGGACCAGGACATGCAGGAGCAGCTGCGCCGCGACG
GCCTGATCGGCGAAGAGCAACAGGAGCTGCGCCATCGCTTCAAACAGGCGCTGCGCACCCTGAAAACCTC
CAGCCTCTACCGCGGGCGCAGCGAGAAATGGCGCAGCGAGCTGCCCTGGTACTTGCTGATCGGCCCGCAG
GGCAGCGGCAAGACCAGCCTGCTGGATTTCTCCGGGCTGGATTTCCCGCTCAATCGCAGCGAGCAGCAGC
GCCTGACCAAGGACGTCTCCGGCACCCGCTACGCCGACTGGTATTTCGCCGATCATGCCGTGCTGATCGA
TACTGCCGGCCGTTACCTGACCCAGCCCGACGCCGCCGTCGACGGTAGCGCCTGGGACACCCTGCTCGGC
CTGCTGCGCAAGCGCCGTGCCCGACCGCTCAACGGCGTGCTGGTCAACCTGCCGGTGGATCAGCTGCTAG
GCGGCAATGAACTGGAGCTGGAGAACCTTGCCCGTCAGGCCCGCCAGCGTCTGCATGAGATTCACCAGCG
CCTGGGCGTCGATGTACCCGTCTATCTGGTGCTGAGCAAGGCCGATCGGATTCTCGGTTTCGACGAGTTC
TTCGATCAGCTGTCCCGCGAGGAAAGCGATCAGGTACTCGGTGCCAGCTTCCGTAAGGAGCAGAATGGCA
GCGATGCGCAGGTGGTGCGCGAGGAGTTCGAGGAACTGCTGCGCCGGCTGAACAGCCAGGTGATCATGCG
CATGCACCAGGAACGTGACAGCCAGCGCCGCGGACGCATCCTCGACTTTCCGCATCAGCTGGGGCAGATC
GGCGAGCGCCTGAGCCTGTTCATCGAACTCGCGTTTGCCGGCAACCGCTACCAGCGTGCCAGCCAGTTGC
GTGGTTTCTACCTGACCAGCGCGCCGCAGCTACGCGAAGGTCTCGACCCGCTCACTGCCGGCATCGGCCG
CCAGTTCGGCCTGGCCAGCAGCGCACTGCCGACCTTCCGCAGCGGTCGCGCACGCTTCATCAATCAACTG
CTCAGCCGGGTGATCTTTCCCGAAGCCGAACTGGCGGGCCTCGACCAGCGCGAGGTCCGCCGCATCGACT
GGGGCCAGCGCGCGCTTTATGCCGGCGCCTTCGGTTGCCTGGTGCTGTTCGGCGGCGCCTGGGCACTGAA
CTTCTCCAGCAACCACGAGCGCCTCGAACAGCTGCGCGGCATCGCCCAGACGCTGGGCGGCGAACGCAAG
ACCATCGAGGTGGAAGACGAAGCACTGCGGACCCTCAAGGTGCTCGATGGCAGCTACGCGGCAACCCAGG
TATTTCCGCCCAGGGACGATGTGTCCTGGCTACGCCGCGGTGGCCTGTATCAGGGCGAGGCGGTCGACCC
GACATTGCACGACGCCTACCGCCGCGATCTGGAAACGCTGCTGCTGCCACGAGTCGGTCGGCAGCTGGAA
GCGCAGATCCGCGCCAACCTGAATGATCGCGAACAGCTGCTCGGTAGCCTGCGCGCGTACCTCATGTTGA
ACCTGGCCGAGCGCCGTGATGCGGCGTTTCTCAAGGACTGGCTGGCCGCCGACTGGTCGCTGCGCCATAG
CGGCAACGCAGTTGCCCAGCAAGGCCTGAACACCCATTTTGCTCGTCTGCTGGAGGAGTCGTTCGCGCCC
TATCAGCTGAACGACAATCTGGTGGCCAAGGCCCGCGCCCAGCTGCGCAGCGAATCGTTGGCAGCAGTGG
TCTACCGCATGCTGCGCGATCAGGCGCGCAACCTTCCCGACTATCGACTGAACACGCAGCTCGGCCCGCA
GGCGTCACTGTTCGTCGGCGGCAACTATGCGATTCCCGGCTTCTATACCCAGCGTGGCTATCAGAAGCTG
TTCGCCGCCCAAGGCGCCGAGCTGGTCAGCGAAATCCTGCGCGACAACTGGGTGCTGGGCGAAGGTGACA
GCCTCAGTGCCAAGGACCTCGGCCGCCTGCTGGTGGAAATGGAGCAGCTTTACTTCCGTGACTACGCCAC
ACACTGGAGCGAGGCAATCACCCAGCTGAACGTCCTCCCGGCCGGTAGTGCGGCGCAGGGTGCCGCGCAG
CTCGCCGGGCTCACCGCAGCCAACTCGCCGCTGCTGCAACTGCTGCTGGCGGTGCGGGAAAACACCCGCT
TCGCCGGCCTCGCCGACGCGACTGCGGAGGCCGGCGAACTGGCCGATACCGCCCAGAACGCCGGAGGCAA
GCTTGGCAAGGCGGCCAAGCTTGCCACCGCCGCGGCGGAGCAGGCACAGGCTGCATTGCTGAAGAACGTA
CCGGACACCGCACGCAAGACCCTCGAACGCCGCTTCGCGCCGCTGCACCAGCTGCTCGACGAAAACGGCG
CGGCTGGGCCGGAGCTGACGGCAAGCCTGCAGGCGCTCGACGCCCTGCAATTGCAGCTGGCCTCACTGGC
CCACGCCAGCGCACCGGAACAGGCCGCATTCGAGATGGCCAAGGCGCGCATGGGCGGTCAGCGCGACGCC
ATCAACCAGCTGCGCAGCAGTGCTTCACGGCTGCCGCAACCAGTCGGCAAGTGGCTTGGTCTGCTGGCCG
AGGACAGCTGGTCGCTGGTGCTCAGCGACGCCTATCACTACCTCAACCAGCGCTATCGCAACGAGCTCTA
CGCCAGCTACCGCGGTTCGCTGCGCGAGCGTTATCCGTTCAGCGCACACAGCGCCAGCGACGTCGCCCTC
GCTGACTTCCGCGAGTTCTTCAAGGCCCAGGGTCTGGCAGACAGCTTCTTCGAGCGCTACCTCAAACCCT
TCGTCAGCGGCAGCGCTGGTCAGTACCAACTGCGCCGGGTCGACGGTCGCGGCCTGCCACTGTCCGAGCA
GTTCCTCGCGCAGATGAGCCGGGCGCAGACCATTCGCCGCAGCTTCTTCGCCGAGAACCCCAACGAGCCG
CAGATCCTGTTCAAGCTGGAGCCCTATTCGCTGGATTCGAGCCTCGGTCGTGCCGACTTCCGCTTCGGTA
ACCAGCAGATGGAGTATCGCCACGGTCCGATCGTGCAGACCGCATTCCGCTGGCCAGCCGAGGCCGACGA
CGGGCGCACCAGCCTGGTGGTGGAAGAACTCGGCGGGCGTCGCGTCGGCATCGAGAAGAACACCGGCCCT
TGGTCGCTGTTCCGCCTGATCGACCTGATGCAGGTCGACTACCACAGCGGCCGCGACGTGCTGATGCTCA
AGGCCGATCTCGGCGGCCTGCGCGCTAACTACCTGCTGCACGCGCAGCGCTCGCCGAATCCTTTCGACCT
CGCGCTGCTGCGCGGCTTCAAGCTGCCGGCGACGCTGTGA
 Primer design