SecReT6
Protein ID: 392423216
SecReT6 ID672
T6SS typeN/A
Gene symbol-
Locus tagA458_20910
StrainPseudomonas stutzeri CCUG 29243
Repliconchromosome [GenBank: NC_018028] [Browse all T6SS(s) in this replicon]
Location [Strand]4508218..4508949 [+]
Productserine/threonine phosphoprotein phosphatase Stp1
NoteStp1
UniProt IDI4CZ90
KEGG IDpsc:A458_20910
PDB IDNA
Domain hit(s) vs Pfam PP2C_2 [PF13672], Evalue: 4.30E-15, Aligned region: 20..206
PP2C [PF00481], Evalue: 1.60E-12, Aligned region: 30..199
SpoIIE [PF07228], Evalue: 1.00E-08, Aligned region: 37..243
Protein Sequence: 243 a.a.     [Download]
>gi|392423216|ref|YP_006459820.1| serine/threonine phosphoprotein phosphatase Stp1 [Pseudomonas stutzeri CCUG 29243]
MSATACSWRSAARTDTGKVRARNEDAFLDLPQAGLWAVADGMGGHQNGALASRLIVEQLADLSSTGDLPE
RVLALRCCLHELNRRLSQELTITAERPDPVIGSTVVALLVEDDRAACIWAGDSRCYLWRSGRLYQLSRDH
SLLQQLLDEQQLTPEQAARHPAAHALTRAIGASEKLELDILEFGVFPGDTLLLCSDGLHQSMSADALGAA
LSLPSTHLALERLFRQALKGPARDNISAVVIRR
 
Nucleotide Sequence: 732 bp     [Download]
>gi|392419087|ref|NC_018028.1|:4508218-4508949 Pseudomonas stutzeri CCUG 29243 chromosome, complete genome
ATGAGCGCGACGGCGTGTAGCTGGCGCAGCGCGGCGCGCACCGACACTGGCAAGGTGCGGGCGCGCAACG
AAGATGCCTTCCTCGACCTCCCGCAGGCCGGCCTCTGGGCCGTGGCCGACGGCATGGGCGGACACCAGAA
CGGCGCGCTGGCGAGTCGCCTGATCGTCGAGCAGCTGGCCGATCTGTCCTCTACGGGCGACCTGCCAGAG
CGGGTGCTGGCGCTGCGGTGCTGCCTGCACGAGCTGAATCGCCGGCTCAGCCAGGAACTGACGATCACCG
CCGAACGCCCGGACCCGGTGATCGGCAGCACCGTGGTCGCCCTGCTCGTGGAGGATGACCGCGCGGCATG
CATCTGGGCCGGCGACAGCCGCTGTTATCTGTGGCGCAGTGGGCGGCTCTATCAGCTATCGCGGGATCAT
TCGCTGTTGCAGCAGCTGCTCGACGAGCAACAACTGACCCCCGAACAAGCGGCCAGGCATCCTGCGGCCC
ATGCGCTGACCCGCGCCATCGGGGCCAGTGAAAAGTTGGAGCTGGACATCCTCGAGTTCGGGGTGTTTCC
CGGCGACACGCTGCTGCTATGCAGCGATGGGCTTCATCAAAGCATGTCCGCCGACGCCCTCGGTGCGGCA
CTCAGCCTCCCATCCACACACCTGGCACTGGAGCGGCTGTTTCGCCAGGCATTGAAGGGGCCGGCACGGG
ACAACATCAGCGCCGTGGTGATCCGCCGATGA
 Primer design