SecReT6
Protein ID: 392423217
SecReT6 ID672
T6SS typeN/A
Gene symbol-
Locus tagA458_20915
StrainPseudomonas stutzeri CCUG 29243
Repliconchromosome [GenBank: NC_018028] [Browse all T6SS(s) in this replicon]
Location [Strand]4508946..4509923 [+]
Productserine-threonine kinase Stk1
NoteStk1
UniProt IDI4CZ91
KEGG IDpsc:A458_20915
PDB IDNA
Domain hit(s) vs Pfam Pkinase [PF00069], Evalue: 4.70E-34, Aligned region: 43..266
Pkinase_Tyr [PF07714], Evalue: 8.70E-22, Aligned region: 45..297
APH [PF01636], Evalue: 0.0031, Aligned region: 129..192
APH [PF01636], Evalue: 0.0031, Aligned region: 220..306
Protein Sequence: 325 a.a.     [Download]
>gi|392423217|ref|YP_006459821.1| serine-threonine kinase Stk1 [Pseudomonas stutzeri CCUG 29243]
MNAPQLQASDLTYFALASTAATPAAVKPKTAPGELPDVLGGRYRIERLLGVGGMGAVYRARDLLREQFGD
PEPYVALKTLSEDFAEYPDASALLYSEYALTTRLSHRHVVRLYNFDIDPASQRAFITLELLKGPTLDQLL
CERPQGMAWSELQGIALPLLEALSYSHSLGVLHGDLKPSNVMLAEDGLRLFDYGLGQPLEGLLPGLPRLC
RTRFAAWTPRYAALELLDGGELTASADIYALACVLYELASGSHPFRRLSARQAKAMELDRALQRPPQLPA
HCWPALRLALAFDEAQRSIDAAGLLHAFSRPAPSRLQRWFGHSHG
 
Nucleotide Sequence: 978 bp     [Download]
>gi|392419087|ref|NC_018028.1|:4508946-4509923 Pseudomonas stutzeri CCUG 29243 chromosome, complete genome
ATGAATGCACCGCAACTGCAGGCCAGCGACCTCACCTACTTTGCCCTGGCGTCCACCGCGGCCACGCCAG
CAGCGGTCAAACCGAAGACAGCCCCTGGCGAGCTGCCGGACGTGCTCGGTGGCCGCTACCGGATCGAGCG
CCTACTCGGCGTCGGCGGCATGGGTGCGGTCTATCGCGCGCGCGATCTGCTGCGCGAACAGTTTGGTGAT
CCGGAACCTTACGTGGCGCTGAAGACGCTCAGCGAGGATTTCGCCGAATACCCCGACGCCAGCGCGCTGC
TCTACAGCGAGTACGCACTGACGACACGCCTCAGCCATCGGCATGTGGTGCGCCTGTACAACTTCGATAT
CGACCCGGCCAGCCAGCGCGCCTTCATCACCCTGGAACTGCTCAAGGGGCCAACCCTCGACCAACTGCTG
TGCGAACGCCCGCAAGGCATGGCCTGGAGCGAACTGCAGGGCATCGCGTTACCGCTGCTGGAAGCGCTGA
GCTATTCCCACAGCCTGGGCGTGCTGCATGGCGACCTGAAGCCGAGCAACGTGATGCTCGCCGAGGACGG
CCTGCGCCTGTTCGATTACGGCCTCGGCCAGCCGCTGGAAGGGCTGCTACCCGGTCTGCCGCGCCTGTGT
CGCACGCGTTTTGCGGCCTGGACGCCGCGCTATGCGGCACTGGAACTGCTCGACGGCGGCGAGCTGACCG
CCAGCGCCGATATCTATGCGCTGGCCTGCGTGCTCTACGAACTGGCCAGCGGCAGCCATCCGTTTCGCCG
GCTCAGCGCTCGCCAGGCCAAGGCGATGGAACTGGACCGCGCCCTGCAACGGCCGCCTCAGCTGCCCGCG
CACTGCTGGCCGGCACTGCGTCTGGCGCTGGCATTCGACGAAGCGCAGCGCAGCATCGATGCGGCAGGTC
TGTTGCACGCCTTCAGCCGCCCCGCACCGAGCCGCTTGCAGCGCTGGTTCGGTCACTCCCATGGATGA
 Primer design