SecReT6
Protein ID: 392423218
SecReT6 ID672
T6SS typeN/A
Gene symbol-
Locus tagA458_20920
StrainPseudomonas stutzeri CCUG 29243
Repliconchromosome [GenBank: NC_018028] [Browse all T6SS(s) in this replicon]
Location [Strand]4509945..4511993 [+]
ProductRhs element Vgr protein
NoteTssI
UniProt IDI4CZ92
KEGG IDpsc:A458_20920
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.90E-76, Aligned region: 29..330
Phage_base_V [PF04717], Evalue: 4.10E-25, Aligned region: 378..471
DUF2345 [PF10106], Evalue: 0.00013, Aligned region: 581..623
Protein Sequence: 682 a.a.     [Download]
>gi|392423218|ref|YP_006459822.1| Rhs element Vgr protein [Pseudomonas stutzeri CCUG 29243]
MFNAANETHFSLTLEGVEHDLQVLAFSGREAISQPYRFDLELVSEHPDLDLESLLHRPAFLALSSDGSGI
HGLVHQAAQGESGKRLTRYRLTLVPQLAYLAHRTNQRIFQHLSVPQIVAQVLEEHGIQANAYRFQLGPVI
YPPREYCVQYDETDLHFIQRLCEEEGIHYHFEHSTRGHVLVFGDDQTSFARLGQPTAYLQDNGMAADEPV
IKRFAVRVATRTSRVSRRDYDFEQPRLLMEAAYRAEPAQASNSQPDLEDYDYPGRFTERARGKHLSQRAL
ERHRSDCRLAEGSSDQPGLVSGHLLEISDHPRREWNDLWLLTEVLHEGKQPQVLEESITNNVDTGDGFAQ
GYRNRFSATPWDIPFRPALDHPKPKVLGSQTAVVTGPAGEEIHCDEYGRVRVQFHWDRHGQADDKTSCWL
RVSSSWAGDRYGGIAIPRVGMEVLVTFLEGDPDQPLVTGCLYHKEHQVPYDLPANKTRTVFKTLSSPGGG
GYNELRIEDRKGAEQIYIHAQRDWDENIEHDQKIRVGHERHDTVEANSYSEFRTEEHLAVAGDRKVEVKP
DDHLTVAHTQHIKLGTAHLTKAGREIHLKAGQKMVIEAGIELTLKAGGSFIKLDPGGITVSGPLARINAG
GTPGKGSGIKIKSPVLPGMADSDKAGSLLEQAMPGEAESLLSKRKRSLNFSG
 
Nucleotide Sequence: 2049 bp     [Download]
>gi|392419087|ref|NC_018028.1|:4509945-4511993 Pseudomonas stutzeri CCUG 29243 chromosome, complete genome
ATGTTCAACGCGGCCAATGAAACCCACTTCAGCCTGACGCTCGAAGGCGTGGAGCACGATCTGCAGGTCC
TCGCCTTCAGTGGTCGGGAAGCCATCAGCCAACCGTATCGCTTCGACCTCGAGCTGGTCAGCGAGCACCC
CGATCTGGATCTGGAAAGCCTGCTGCATCGCCCGGCCTTCCTCGCCTTGTCGTCGGACGGCAGCGGCATC
CACGGGCTGGTGCATCAGGCCGCCCAGGGTGAATCCGGCAAGCGCCTGACTCGCTATCGCCTTACGCTCG
TTCCGCAACTGGCCTATCTCGCGCATCGCACCAACCAGCGCATCTTCCAGCACCTCAGCGTGCCGCAGAT
CGTCGCCCAGGTGCTCGAGGAGCATGGCATCCAGGCCAACGCCTACCGCTTCCAGCTCGGCCCGGTGATC
TACCCGCCGCGCGAATATTGCGTGCAGTACGACGAAACCGACCTGCACTTCATCCAGCGCCTGTGTGAGG
AAGAAGGTATCCATTACCACTTCGAGCACAGCACCAGAGGTCATGTGCTGGTTTTCGGCGATGACCAGAC
CAGCTTCGCCAGACTCGGCCAGCCGACCGCCTATCTGCAGGACAACGGCATGGCGGCCGACGAGCCGGTG
ATCAAGCGCTTCGCCGTGCGTGTCGCGACACGCACCAGCCGCGTCAGCCGTCGTGACTATGATTTCGAGC
AGCCCAGATTACTGATGGAAGCGGCCTATCGCGCCGAGCCAGCACAGGCCTCCAACTCGCAACCAGACCT
CGAAGACTACGACTATCCGGGTCGCTTCACCGAGCGCGCCCGTGGCAAGCACTTGTCGCAACGCGCTCTG
GAGCGCCATCGCAGCGATTGCCGCCTCGCCGAGGGCAGCAGCGATCAGCCTGGCCTGGTCAGCGGTCATC
TGCTGGAGATATCCGACCATCCACGCCGGGAATGGAACGACCTCTGGCTGCTCACCGAGGTGCTGCATGA
AGGCAAGCAGCCGCAGGTGTTGGAAGAGTCGATCACCAATAACGTCGATACCGGTGACGGCTTTGCCCAG
GGCTACCGCAACCGTTTCAGCGCCACGCCCTGGGACATTCCTTTCCGTCCGGCACTGGACCATCCGAAGC
CGAAGGTGCTTGGCAGCCAGACCGCCGTGGTCACCGGTCCTGCCGGCGAAGAAATCCACTGCGACGAATA
CGGCCGAGTACGCGTCCAGTTCCATTGGGATCGCCACGGCCAGGCCGACGACAAGACCAGCTGCTGGCTG
CGCGTCAGCTCCAGCTGGGCCGGCGACCGCTACGGCGGCATCGCGATCCCGCGCGTTGGCATGGAAGTGC
TGGTGACCTTCCTCGAAGGCGACCCCGATCAGCCGCTGGTCACCGGCTGCCTGTACCACAAGGAACACCA
GGTTCCTTACGACCTGCCGGCGAACAAGACCCGCACGGTGTTCAAGACCCTCAGCTCACCAGGCGGTGGC
GGCTACAACGAACTGCGCATCGAAGACCGCAAGGGCGCCGAACAGATCTACATTCACGCCCAGCGCGACT
GGGACGAGAACATCGAGCACGACCAGAAGATCCGCGTCGGCCACGAGCGTCACGACACGGTGGAGGCCAA
CAGCTACAGCGAATTCCGCACCGAGGAGCACCTGGCCGTTGCCGGCGACCGCAAGGTCGAAGTCAAACCC
GACGACCACCTCACTGTCGCCCATACCCAGCACATCAAGCTCGGCACTGCCCATCTGACCAAGGCCGGCC
GCGAGATCCACCTCAAGGCCGGGCAGAAAATGGTCATCGAAGCCGGCATCGAACTGACCCTCAAGGCCGG
CGGCAGCTTCATCAAGCTCGACCCAGGCGGCATCACCGTCTCCGGCCCGCTGGCACGAATAAACGCCGGC
GGCACGCCGGGCAAGGGCTCGGGGATCAAGATCAAATCACCGGTGCTGCCGGGAATGGCCGATAGCGACA
AGGCCGGAAGCCTACTGGAGCAGGCAATGCCAGGTGAGGCGGAAAGTCTGCTCAGCAAACGCAAGCGCTC
GCTCAATTTTTCAGGCTAA
 Primer design