SecReT6
Protein ID: 392979536
SecReT6 ID673
T6SS typei3
Gene symbol-
Locus tagA3UG_13480
StrainEnterobacter cloacae subsp. dissolvens SDM
Repliconchromosome [GenBank: NC_018079] [Browse all T6SS(s) in this replicon]
Location [Strand]2897159..2900779 [-]
Producttype VI secretion system protein ImpL
NoteTssM
UniProt IDI6RAI1
KEGG IDenl:A3UG_13480
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 3.20E-99, Aligned region: 208..483
ImcF-related_N [PF14331], Evalue: 3.20E-99, Aligned region: 761..817
IcmF-related [PF06761], Evalue: 9.10E-93, Aligned region: 531..836
DUF1215 [PF06744], Evalue: 1.30E-29, Aligned region: 947..1072
Protein Sequence: 1206 a.a.     [Download]
>gi|392979536|ref|YP_006478124.1| type VI secretion system protein ImpL [Enterobacter cloacae subsp. dissolvens SDM]
MLTTLLSILTNRILWSFLGVTALSAVIWMIGPLLSIVDTRPLESEQNRIISIAVVYLLWAQGHIVPRLYN
AWLNRKLMDKLNENTTKPDAADPQKRLNSEEQILAGRFDEAAQMLKKAHFSKAGHGAQWTQRFSTQYLYQ
LPWYVIIGAPGAGKTTALVNSGLQFPLADRFGKTALRGIGGTRNCDWWFTNEAVLLDTAGRYTTQESEQV
QDAGEWLEFIGLLRKYRRRQPINGVIITISISDLLTLSPEAARQQAVNLRQRLSELHEQLGIRFPVYVMV
TKADLLKGFRAWFADYDKAQRDQIWGFTLPWEQTKHADFDLMGNFHQEFSLLQQRLDAGLPETMLKEHDA
KTRAEAYLFPQEFAALRPLLADYLSTVFARSNFETEFSPRGIYFASGTQEGMPFDRVMGELNRALSLPEG
AEAEKWDSVSKEAPIPGAKGQSFFIKNLLQNVIFQEAGIAGENRWWELRNRAVIWSGYAALLALLVILGG
LWLTSYAKNKAYLEEVDAKVPQLEQQSKALQNQPQRDLFALLPLLNSLVDLPKSEAFDVNDPPVSRRMGL
YRGDDVSDASQSLYQKALDQMLLPAVAMHITTWLRNDNGSDVEYSYEALKAYQMLYQPKHYDGKFLHSWV
MLNLQRNLPQNVTQAQLQQLEWHLTQLLEPKIQASPYAQDEGLVARERALINQQPLSTRVYGRLKRLLEH
DENLKPVSLSDLGGPQSELVFSRKSGKPVSEGVPGLYTPDGYWKSFNGQIDSVTTALHEDDAWVLGATTS
GEDKQQIDNAVRQLYMRDFIANWDRFLADIQLNNSADLSQRINTARLLSGANSPLRRLVQNLSQVLTLSR
NAPAPEDAGKAQDQSNRATRTLEALFSNNDNAPTQGAVVTQAPEQLVTDHYAPMIELAQPLEKGGKTIVF
DDFLKQVDELYRYLTAVQDAANSGMPAPGGEAISRLQASAGRLPGGLQTMFSNMAVGASSDTQRRDLENV
RKRINVEVGGFCRQAIAGRYPLVRSASTEVTPDDLARMFAPGTGLMDTFFRDNLTNKVDTTQANWRFMPG
IDGKTLPGSEGLLRPFQQAQSIRDAFFANGATTPSFKVTVRTVRMDNTILNLTLDVDGQLLRYSHGPQAV
QIMNWPGPGGTNQVRMQLGLANGSTATLVTNGAWALNRFLDKARTSPGAGSLSRQATFNVDGHQVTLEFA
PNSIRNPFQLPRFSCP
 
Nucleotide Sequence: 3621 bp     [Download]
>gi|392976867|ref|NC_018079.1|:c2900779-2897159 Enterobacter cloacae subsp. dissolvens SDM chromosome, complete genome
ATGCTGACGACTCTTCTTTCCATACTGACCAATCGCATTCTGTGGAGCTTCCTGGGCGTTACCGCGCTGT
CGGCGGTGATCTGGATGATTGGTCCGCTGTTATCCATCGTGGATACCCGCCCGCTCGAATCTGAACAAAA
CCGCATCATCAGTATTGCGGTGGTTTATCTGCTCTGGGCGCAGGGGCATATTGTGCCGCGGCTGTACAAC
GCCTGGCTGAACCGCAAGCTGATGGACAAGCTCAATGAAAATACCACCAAACCGGACGCGGCCGATCCCC
AGAAGCGGCTGAACAGCGAGGAGCAGATCCTCGCTGGACGTTTTGATGAAGCGGCGCAAATGCTGAAGAA
AGCCCACTTCAGCAAAGCGGGACACGGTGCCCAGTGGACGCAGCGCTTCAGTACGCAATATCTCTACCAA
CTGCCGTGGTACGTCATTATCGGCGCACCGGGCGCCGGTAAAACCACGGCGCTGGTCAATTCCGGCCTGC
AATTCCCGCTGGCGGATCGCTTCGGTAAAACCGCTCTGCGCGGCATTGGCGGCACGCGCAACTGCGACTG
GTGGTTCACGAACGAAGCTGTCCTGCTGGACACCGCGGGGCGCTACACCACCCAGGAGAGCGAGCAGGTT
CAGGATGCCGGAGAGTGGCTGGAATTTATCGGCCTGCTGCGTAAGTATCGCCGCCGCCAGCCTATCAACG
GCGTCATTATCACCATCAGCATTTCCGATCTGCTGACGCTCTCCCCGGAGGCGGCGCGCCAGCAGGCGGT
CAACCTGCGCCAGCGGCTGTCTGAGCTGCATGAACAGCTGGGTATCCGCTTCCCGGTTTACGTGATGGTG
ACCAAGGCGGACCTGCTTAAAGGCTTCCGCGCCTGGTTTGCTGACTACGACAAAGCGCAGCGCGACCAGA
TTTGGGGCTTCACCCTGCCGTGGGAACAGACCAAACACGCCGATTTCGACCTGATGGGTAACTTCCATCA
GGAGTTCTCGCTGTTGCAGCAGCGACTGGACGCCGGGCTGCCGGAGACCATGCTGAAAGAGCATGACGCC
AAAACCCGTGCCGAAGCGTATCTCTTCCCGCAGGAGTTCGCGGCGCTGCGCCCGCTGCTGGCAGACTACC
TGAGCACGGTCTTTGCCCGCTCTAACTTTGAGACCGAGTTCTCCCCACGCGGAATATACTTCGCCAGCGG
CACCCAGGAAGGCATGCCGTTCGATCGCGTCATGGGTGAACTGAACCGCGCCCTGTCACTGCCGGAAGGG
GCAGAGGCAGAGAAGTGGGATTCGGTCAGTAAAGAGGCGCCGATCCCGGGAGCGAAAGGGCAGAGTTTCT
TTATCAAGAACCTGCTGCAGAACGTCATTTTCCAGGAAGCGGGCATCGCCGGCGAAAACCGCTGGTGGGA
ACTGCGCAACCGCGCGGTGATCTGGTCCGGTTATGCGGCACTGCTGGCGCTGCTGGTGATCCTCGGCGGA
CTGTGGCTGACCAGCTATGCGAAGAATAAGGCCTATCTGGAAGAGGTGGACGCTAAAGTCCCGCAACTGG
AGCAGCAGAGTAAAGCGTTACAGAATCAGCCTCAGCGCGATCTGTTCGCGCTCCTGCCGCTGCTGAACAG
CCTGGTCGATTTGCCGAAAAGCGAGGCCTTCGATGTCAACGACCCGCCGGTCTCCCGCCGTATGGGGCTG
TATCGCGGGGATGACGTCAGCGATGCTTCTCAGTCGCTGTACCAAAAAGCGCTGGACCAGATGCTGCTGC
CCGCCGTGGCGATGCATATCACCACCTGGCTGCGCAACGACAACGGCAGCGATGTGGAATACAGCTACGA
GGCGCTGAAAGCCTATCAGATGCTGTATCAGCCGAAACACTACGACGGCAAATTCCTGCACTCCTGGGTG
ATGCTCAATTTGCAGCGTAATCTGCCGCAGAACGTGACGCAGGCGCAGTTGCAACAGCTGGAGTGGCACC
TGACTCAACTGCTGGAACCAAAAATTCAGGCCTCGCCGTATGCGCAGGATGAAGGGTTGGTGGCCCGCGA
GAGGGCGCTCATCAACCAGCAGCCGCTCTCCACCCGCGTGTATGGGCGTCTGAAGCGTCTGCTGGAGCAT
GACGAGAACCTGAAGCCGGTCTCCCTGTCCGACCTGGGCGGCCCGCAGAGCGAACTGGTGTTCTCCCGCA
AAAGCGGCAAACCGGTGAGCGAAGGCGTGCCGGGGCTCTATACCCCGGACGGCTACTGGAAGAGCTTTAA
CGGCCAGATTGACAGCGTGACCACGGCGCTGCACGAAGACGATGCCTGGGTGCTGGGCGCGACCACCTCC
GGGGAAGACAAACAGCAGATCGATAACGCCGTGCGTCAGCTCTACATGCGCGACTTTATCGCAAACTGGG
ATCGTTTCCTCGCCGACATTCAGCTTAACAACAGCGCCGATCTCTCGCAGCGCATCAACACGGCGCGCCT
GCTCTCCGGCGCAAACTCGCCGCTGCGTCGTCTGGTGCAGAACCTGAGCCAGGTGCTGACGCTGTCGCGC
AACGCGCCAGCGCCGGAGGATGCGGGGAAAGCGCAAGACCAGAGCAACCGCGCCACCCGTACCCTCGAAG
CGCTGTTCAGCAATAACGACAATGCCCCGACGCAGGGGGCGGTGGTGACGCAGGCACCTGAACAGCTGGT
GACCGACCACTACGCGCCGATGATCGAGCTGGCTCAGCCGCTGGAGAAGGGCGGCAAGACCATCGTCTTT
GATGATTTCCTCAAGCAGGTGGATGAGCTGTATCGTTACCTGACCGCGGTGCAGGACGCTGCCAACAGCG
GCATGCCAGCCCCGGGCGGTGAAGCAATCAGCCGTCTGCAGGCCAGCGCCGGGCGTCTGCCGGGCGGGCT
GCAAACCATGTTCAGCAACATGGCGGTGGGAGCCAGCAGTGATACCCAGCGTCGCGATCTGGAAAACGTC
CGTAAGCGCATTAACGTCGAAGTGGGCGGTTTCTGCCGTCAGGCAATTGCCGGTCGCTACCCGCTGGTGC
GCAGCGCCAGCACCGAGGTGACGCCGGACGATCTGGCACGCATGTTTGCGCCGGGTACCGGGCTGATGGA
CACCTTCTTTCGCGACAACCTGACCAACAAAGTGGATACCACTCAGGCGAACTGGCGCTTTATGCCGGGG
ATCGACGGGAAAACGTTACCGGGAAGTGAAGGACTGCTGCGCCCGTTCCAGCAGGCGCAGTCCATTCGCG
ATGCCTTCTTTGCTAACGGTGCAACGACGCCGTCTTTCAAGGTGACGGTGCGTACCGTGCGCATGGATAA
CACCATTCTCAACCTGACGCTGGACGTCGACGGTCAGCTGTTGCGTTACAGCCACGGCCCACAGGCGGTG
CAGATCATGAACTGGCCAGGACCGGGCGGCACCAACCAGGTGCGTATGCAGCTGGGGCTGGCCAACGGCA
GCACCGCGACGCTGGTGACCAACGGCGCCTGGGCGCTGAACCGCTTCTTAGATAAAGCGCGCACCAGCCC
TGGGGCAGGTAGTCTGAGCCGTCAGGCCACGTTCAACGTCGATGGCCATCAGGTCACGCTGGAGTTTGCG
CCGAACAGCATTCGCAATCCGTTCCAGCTTCCTCGTTTCTCATGCCCATAA
 Primer design