SecReT6
Protein ID: 392984089
SecReT6 ID675
T6SS typei4a
Gene symbol-
Locus tagPADK2_13465
StrainPseudomonas aeruginosa DK2
Repliconchromosome [GenBank: NC_018080] [Browse all T6SS(s) in this replicon]
Location [Strand]2900192..2903800 [+]
Producttype VI secretion system protein ImpL
NoteTssM
UniProt IDI6SJ04
KEGG IDpdk:PADK2_13465
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 5.50E-35, Aligned region: 45..285
Protein Sequence: 1202 a.a.     [Download]
>gi|392984089|ref|YP_006482676.1| type VI secretion system protein ImpL [Pseudomonas aeruginosa DK2]
MLHLASAALLPVARPAWFGRWWSDGEGAILLVPESVFLPDEGLRRQSGAWLRLLRLFLRLRGRRALDGVV
WNIPLARLQDGEQAANLGLAARRRYVELTQRLGLSLPVYVVITGMEDLPGFQELLAALPEEARERALGWS
SPFAAEAAWQSRWCEQALEEITATLTESIVELGTLRGQVDNELYCLPPRLESLRGSLQALLEPVFQGNAR
GEAPRFRGLYLSGSEAAGAAADEVLPAVDAPRRRSSFASQLWARRILAEEGLAQAVPRILQLRQRWQRGI
GLAALCLCLLWGGLMTWVWRDALRDAGELSQLLHGASERYQPLDDDTRRAAQVRQNVQAWWQLVSQAPRW
RFTSLAFPSSWFSSLDARIDNAYRRVSERLLVRPLRSLLEGEASDLRAIRSDGQPGLKEGDDPSQWKDYL
AAKDLVARATTLERHNRLFAQAIDNRRTPLDDLLQLSNDALGSSYNAGSLARLAYYNRTLFAERPADLAA
LDLGRVAATAADNFHDLMARWLNAYFLTDSLERTGNALTQELAQLGQERDATAAQLLGIGELINHLQQQV
NRINLIWGNGVGQDLVPGYQNLLKSAQQSSLLGNRVEELQNLTVQLQQQFRSEWIAPPEAAGDGLLVKQG
ATLKLADDLLGLKRAIDDLKTKDFVSVALADKTLADHSLLSIDDIGVTQALSFFNDFTGYYESTLPSLNP
RYRYSVLHAAASAATEAMWQSLGPRSRSLASRNASRFDVQVKQVQVLQAALLELQDLQAGARLLLSLNAL
AVADIGQALRDIDEQAVLREPVDFSRWSGAPNFGLQMFRAQDSAELKQSLNSQFNAMAAVAERHAPALEW
LQAQQSSLATADYNAFVRFSALNAELQKFKADNPASTAAQLAKLVGNDFNQMDIGSCADILNGVLLPSSR
SDLATRLVDLRQGALGRCQSLQQQQAAQAWKDLADYFNQYLAGRFPFAYSLEAADAEPGRVRHLLQLMET
RLPQVREGLAQVRSPDLPAAEDFVRRLEQAQRWLGPLFERDKSGLLGVALDIDWRSDRSLERGADQVIAW
SLYSGDQESRFPGAQDKGLTWNVGDPLKIMLRWAKNGSQRPADDPRQASLAVADLEAGWSYQGSWALLRM
MRAHFSRQRPPNVDYTEFPLVLQLPVYAPYSPENEARMFLRLSLMSLGGKTPLSIQPLPVRAPQSPFATL
LPATVVSTGGTP
 
Nucleotide Sequence: 3609 bp     [Download]
>gi|392981410|ref|NC_018080.1|:2900192-2903800 Pseudomonas aeruginosa DK2 chromosome, complete genome
GTGCTCCACCTGGCGTCTGCTGCCCTGCTGCCGGTGGCGCGCCCGGCCTGGTTCGGCCGCTGGTGGTCGG
ACGGCGAGGGGGCGATCCTGCTGGTGCCCGAGTCGGTGTTCCTGCCCGACGAGGGCCTGCGCCGGCAAAG
CGGCGCCTGGCTGCGCCTGTTGCGTCTGTTCCTGCGCCTGCGCGGCAGGCGCGCGCTGGACGGAGTGGTC
TGGAACATTCCGCTGGCGCGGCTGCAGGATGGCGAGCAGGCGGCCAACCTCGGCCTCGCCGCGCGCCGTC
GCTACGTGGAACTGACCCAGCGCCTTGGCCTGAGCCTGCCGGTTTACGTGGTGATCACTGGCATGGAAGA
CCTGCCTGGTTTCCAGGAACTTCTCGCGGCGCTGCCCGAGGAGGCGCGCGAGCGCGCCCTCGGCTGGTCC
TCGCCGTTCGCCGCCGAAGCGGCCTGGCAGTCGCGCTGGTGCGAGCAGGCGCTGGAGGAAATCACCGCCA
CCCTGACCGAGTCGATCGTCGAACTCGGTACCTTGCGCGGCCAGGTGGACAATGAGCTGTATTGCCTGCC
GCCACGCCTGGAAAGCCTCCGCGGTTCGTTGCAGGCGCTGCTCGAACCGGTCTTCCAGGGCAACGCCAGG
GGCGAGGCGCCGCGCTTTCGCGGTCTCTACCTGAGCGGCAGCGAGGCGGCGGGCGCGGCAGCCGACGAAG
TCCTGCCGGCGGTCGACGCGCCGCGTCGGCGCAGCAGCTTCGCCAGCCAACTGTGGGCACGGCGGATCCT
TGCCGAGGAAGGCCTGGCCCAGGCGGTGCCGCGCATCCTCCAGCTGCGTCAGCGCTGGCAGCGCGGGATC
GGCCTCGCCGCGTTGTGCCTGTGCCTGCTCTGGGGCGGCCTGATGACCTGGGTCTGGCGCGACGCGCTGC
GCGACGCCGGTGAACTGTCGCAACTGCTGCATGGCGCCAGTGAGCGCTACCAGCCGCTCGACGACGACAC
TCGGCGCGCCGCCCAGGTCCGGCAGAACGTCCAGGCCTGGTGGCAACTGGTGTCACAGGCGCCGCGCTGG
CGCTTCACTTCGCTGGCGTTTCCCAGTTCCTGGTTTTCCTCCCTGGATGCACGTATCGACAACGCGTATC
GCCGCGTTTCCGAGCGCCTGCTGGTGCGACCGCTGCGCAGCCTGCTGGAAGGCGAGGCGAGCGACCTGCG
GGCGATCCGCAGCGATGGCCAACCCGGCCTGAAGGAGGGCGACGACCCCAGCCAGTGGAAGGACTACCTG
GCGGCGAAGGACCTGGTCGCCCGCGCCACTACGCTGGAGCGCCACAATCGCTTGTTCGCCCAGGCCATCG
ACAACCGCAGGACGCCGCTCGACGACCTTCTGCAACTGAGTAACGATGCCTTGGGCAGCAGCTACAACGC
CGGCAGCCTGGCGCGCCTGGCCTATTACAACCGCACGCTGTTCGCCGAGCGTCCGGCCGATCTCGCCGCC
CTCGACCTGGGCCGGGTCGCCGCCACGGCGGCGGATAACTTCCATGACCTGATGGCACGCTGGCTGAACG
CCTACTTCCTCACCGACAGCCTGGAACGCACCGGCAATGCCCTGACCCAGGAACTCGCGCAGCTCGGCCA
GGAACGAGACGCCACGGCGGCCCAGTTGCTGGGGATCGGCGAATTGATCAACCACCTGCAGCAACAGGTC
AACCGCATCAACCTGATCTGGGGCAATGGCGTCGGCCAGGATCTCGTCCCTGGCTACCAGAACCTGCTCA
AGAGCGCCCAGCAAAGCAGCTTGCTGGGAAACCGCGTGGAGGAACTGCAGAACCTCACCGTGCAGTTGCA
GCAGCAGTTTCGCAGCGAATGGATCGCGCCTCCGGAGGCTGCCGGCGACGGCCTGCTGGTGAAACAGGGG
GCGACGCTCAAGCTGGCCGATGACCTGCTCGGTCTGAAACGCGCCATCGATGACCTGAAGACCAAGGACT
TCGTCTCCGTGGCCCTGGCGGACAAGACACTGGCGGACCACTCCTTGCTGAGCATCGACGATATCGGCGT
GACTCAGGCGTTGAGCTTCTTCAACGACTTCACCGGCTACTACGAGAGCACCCTGCCATCGCTCAACCCG
CGCTATCGCTATTCGGTCCTGCACGCCGCCGCCAGCGCGGCGACCGAGGCCATGTGGCAAAGCCTCGGGC
CGCGCAGTCGTAGCCTGGCCAGTCGCAATGCCTCGCGTTTCGACGTGCAGGTCAAGCAGGTCCAGGTGTT
GCAGGCGGCGCTGCTGGAGTTGCAGGACCTGCAGGCCGGCGCGCGCCTGCTGCTCAGCCTCAACGCGCTG
GCCGTGGCCGATATCGGCCAGGCCCTGCGCGACATCGACGAGCAGGCGGTGCTGCGCGAGCCGGTCGATT
TCAGCCGCTGGTCGGGCGCGCCGAATTTCGGCCTGCAGATGTTCCGCGCCCAGGACAGTGCCGAGCTGAA
GCAAAGCCTGAACAGCCAGTTCAATGCCATGGCGGCCGTCGCCGAACGCCACGCCCCGGCGCTGGAGTGG
TTGCAGGCGCAGCAATCCAGCCTGGCCACCGCCGACTACAACGCGTTCGTGCGCTTCAGCGCGCTCAACG
CCGAACTGCAGAAATTCAAGGCCGACAACCCGGCGAGCACCGCGGCGCAGTTGGCGAAGCTGGTGGGTAA
CGATTTCAACCAGATGGACATCGGCAGTTGCGCCGACATTCTCAACGGCGTGCTCCTGCCGTCCAGCCGC
AGCGACCTGGCGACGCGCCTGGTGGACCTGCGCCAGGGCGCGCTCGGGCGCTGCCAGTCGTTGCAACAGC
AGCAGGCGGCGCAGGCCTGGAAGGACCTCGCCGACTACTTCAACCAGTACCTCGCCGGACGCTTCCCGTT
CGCCTACAGCCTGGAAGCGGCCGATGCCGAGCCGGGGCGGGTGCGGCACCTGCTGCAACTGATGGAGACG
CGCTTGCCGCAGGTGCGCGAAGGGCTGGCCCAGGTTCGCTCGCCGGACCTGCCGGCCGCCGAGGACTTCG
TCCGCCGCCTGGAGCAGGCGCAGCGCTGGCTCGGCCCGCTGTTCGAGCGCGACAAGTCGGGCCTGCTCGG
CGTCGCCCTGGACATCGACTGGCGCAGCGACCGCAGCCTGGAACGCGGCGCCGACCAGGTGATCGCCTGG
AGCCTGTACTCGGGCGACCAGGAAAGCCGTTTCCCCGGCGCGCAGGACAAGGGCCTGACCTGGAATGTCG
GCGATCCGCTGAAAATCATGCTGCGCTGGGCGAAGAACGGCTCGCAGCGTCCGGCAGACGACCCGCGCCA
GGCCAGCCTGGCGGTGGCCGACCTCGAGGCCGGCTGGAGCTACCAGGGCTCCTGGGCGCTGTTGCGCATG
ATGCGCGCGCACTTCTCCCGGCAGCGCCCGCCGAACGTCGACTACACGGAGTTTCCGCTGGTCCTGCAAC
TGCCGGTGTATGCGCCCTACAGCCCGGAAAACGAGGCGCGGATGTTCCTCCGCCTGTCGTTGATGAGCCT
GGGCGGCAAGACCCCGCTGTCCATCCAGCCGCTGCCGGTGCGCGCGCCGCAATCGCCGTTCGCGACGCTG
TTGCCGGCCACCGTCGTCAGCACCGGAGGTACCCCATGA
 Primer design