SecReT6
Protein ID: 392984864
SecReT6 ID676
T6SS typei1
Gene symbol-
Locus tagPADK2_17350
StrainPseudomonas aeruginosa DK2
Repliconchromosome [GenBank: NC_018080] [Browse all T6SS(s) in this replicon]
Location [Strand]3746168..3747157 [-]
Productserine-threonine kinase Stk1
NoteStk1
UniProt IDI6SKX3
KEGG IDpdk:PADK2_17350
PDB IDNA
Domain hit(s) vs Pfam Pkinase [PF00069], Evalue: 4.20E-40, Aligned region: 51..286
Pkinase_Tyr [PF07714], Evalue: 4.60E-25, Aligned region: 53..306
APH [PF01636], Evalue: 4.70E-05, Aligned region: 97..176
APH [PF01636], Evalue: 4.70E-05, Aligned region: 171..203
APH [PF01636], Evalue: 4.70E-05, Aligned region: 228..305
RIO1 [PF01163], Evalue: 0.0028, Aligned region: 128..202
Protein Sequence: 329 a.a.     [Download]
>gi|392984864|ref|YP_006483451.1| serine-threonine kinase Stk1 [Pseudomonas aeruginosa DK2]
MNEPLSSLELLPEEEGGANLTYFAFAAPTASAPDLPAVLPGPLPDVLSGRYRLERMLGAGGMGTVYRARD
LLHEQFGDPAPLVALKLLNESVAESPDASALLYSEFALTRRLRHPNVVRLFTFDVDTACQRAYIVMELMP
GLPLDRLLCERPEGLPWSELSAIARPLLDVLAYVHEQGVLHGDLKPSNVMLGEEGVRLFDFGLGQAQAGI
LDGLPQLSRGRIDAWTPGYAAPELLEGAPLSPAADLYALACVLYELADGRHPFRRLPSNQAREQGLERQL
RAPGHLPRRCWPALRTALSLDPERRCIGVRELQEALGARRSWLAGVLAR
 
Nucleotide Sequence: 990 bp     [Download]
>gi|392981410|ref|NC_018080.1|:c3747157-3746168 Pseudomonas aeruginosa DK2 chromosome, complete genome
ATGAACGAACCGCTGTCGTCGCTGGAGCTGCTGCCGGAGGAGGAGGGCGGCGCGAACCTGACCTATTTCG
CCTTCGCCGCCCCGACCGCCTCGGCGCCGGACCTGCCGGCGGTGTTGCCCGGTCCGCTGCCGGACGTTCT
TTCCGGACGCTACCGTCTGGAGCGGATGCTCGGCGCCGGCGGCATGGGTACGGTCTACCGTGCCCGAGAC
CTGCTCCATGAGCAGTTCGGCGACCCGGCGCCGCTGGTAGCGCTGAAGCTGCTCAACGAGTCGGTCGCCG
AGTCACCCGACGCCAGCGCCTTGCTCTATAGCGAGTTCGCCCTGACCCGGCGCTTGCGCCATCCGAACGT
CGTGCGTCTGTTCACCTTCGACGTCGACACCGCATGCCAGCGCGCCTACATCGTCATGGAACTCATGCCT
GGCCTGCCGCTCGACCGCCTGCTCTGCGAGCGTCCCGAAGGCCTGCCCTGGTCCGAGCTGAGCGCGATCG
CCCGGCCGTTGCTGGATGTTCTGGCCTACGTCCACGAACAAGGAGTACTGCATGGCGACCTGAAACCGAG
CAACGTGATGCTCGGCGAAGAGGGCGTGCGGCTCTTCGACTTCGGCCTCGGCCAGGCGCAGGCAGGCATC
CTGGATGGCCTGCCGCAGCTCAGCCGGGGCCGCATCGACGCCTGGACTCCGGGCTACGCCGCTCCCGAAC
TGCTCGAGGGCGCGCCATTGTCGCCGGCGGCCGACCTGTATGCGCTGGCCTGCGTCCTCTACGAACTGGC
CGACGGTCGCCATCCGTTCCGCCGCCTGCCCTCGAACCAGGCCCGGGAGCAGGGGCTGGAGCGCCAGCTG
CGCGCGCCCGGACACCTGCCTCGGCGCTGCTGGCCGGCGCTGCGTACCGCCCTGAGCCTCGACCCCGAAC
GGCGCTGCATCGGCGTCCGCGAATTACAGGAAGCGCTGGGCGCGCGGCGTTCCTGGCTGGCCGGCGTTCT
TGCCCGTTGA
 Primer design