SecReT6
Protein ID: 395443811
SecReT6 ID667
T6SS typei1
Gene symbol-
Locus tagYSA_00322
StrainPseudomonas putida ND6
Repliconchromosome [GenBank: NC_017986] [Browse all T6SS(s) in this replicon]
Location [Strand]169767..173387 [-]
ProductImcF domain-containing protein
NoteTssM
UniProt IDI3UN78
KEGG IDppi:YSA_00322
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 1.80E-84, Aligned region: 110..154
IcmF-related [PF06761], Evalue: 1.80E-84, Aligned region: 524..831
ImcF-related_N [PF14331], Evalue: 4.10E-69, Aligned region: 218..476
DUF1215 [PF06744], Evalue: 1.00E-29, Aligned region: 928..1049
Protein Sequence: 1206 a.a.     [Download]
>gi|395443811|ref|YP_006384064.1| ImcF domain-containing protein [Pseudomonas putida ND6]
MNQIWTQLKRWGWPWVTRIGLALPLLLGLGALLMLVAIWWLGPQWTWREQQPLASVAHRSVASLVLVLVP
LLCWLGVLRTRFRRLQAERRQALAAEQDVALPFVQAQERALSQGLERYLDNAGGRRALYRLPWYLVLGDE
QAGKSSFIDRTDQRFTLTRIDQAQARGRQAEALAYPVGWWVSDDAVIIDPPGVFISQKPPVGSAANDPTN
ASSPPGIQARLWEHLLGWLQRKRSQRALNGVLLVVDLPALLHGKPEQRVALAHGLRTRLYEVSSQLGARL
PLYVVLTKFDLLDGFDQFYSQLPAAKRESLLGFTFKLDAVDAFDAWLDEYDEHYGRLLTQLHEQVIDRLD
VLGKTAPCVRLFSLHAQLIGLRPILQAFLRETLASDRFTTPPLVRGVYWSSVVQQGDMRNAFVREAAQPY
TTKLPLREGKAQGKALVYFIQQAFRRVIYQEAGLAGDNVRVARSKRHLLWVGSGVGILAFSIAIASWQRY
AEINGAKAASVLAKSQEYSGHEVDMRLDPTGRNLLAPLDQIRDAVAVFGDYRAAWPVVADFGLYQGRNIG
PLVDEAYLSLLSKRFLPALASGVIDAMNAAPPGSEQQMAALRVYRMIEDRNSRRPEWVEGWMARQWQRAF
PGQGQLQRDLMQHLKYALAYADTDLPQYRQRVSEVQQVLRKLPLPQRVYAGLKQQSYEQVHAGLDLRHQV
GPAFDVVYQPSSGSRQGGEDVRLAGMLTAKGFRDYFEPHSQRFAEMAMVDQWALGERSQLDYSDVDRDAL
TERLYNLYSADYIDSWRRALNAFTVADFRDLDHGVAILEQLTGPAAPLQRLLDTVRDNTSLASPAVVESP
GELSTLRVATGKPEQPQALAIQRAFAGLGAMLQATGEKPSYYDETLGAVAAVLDYAKAVQDSPDRGKAAL
QAVHQRFAMTGQDPIGTLQRVATGLPEPISHQVRKLADQTAQVLNVEALRELERRWDADVYSFFQQRLAG
RYPFVVKAPDASLDDFEAFFGPKGRLQQFNDRYLKVFLKDNLEALQSAQHGQSLIRADVIEQLELAERIR
ETFFDQRGKLSVQFSIEPLGLSANQRTSLLDLDGQLIAYTHGPSHITGIVWPNTLGQQVRSNLTLLRQNG
NSSSLEYRGPWSMFRLLSRGALNGRTATSVDLSFRTGDGVMRYRLNAEKAFNPITQQPFKGFRLPRGLLQ
QPANGVQAALSDEQRL
 
Nucleotide Sequence: 3621 bp     [Download]
>gi|395443650|ref|NC_017986.1|:c173387-169767 Pseudomonas putida ND6 chromosome, complete genome
ATGAATCAAATATGGACGCAACTCAAACGTTGGGGCTGGCCGTGGGTAACGCGCATTGGCCTGGCGCTGC
CGCTGCTGCTCGGGCTTGGCGCTTTGCTGATGCTGGTCGCTATCTGGTGGCTTGGCCCGCAATGGACGTG
GCGGGAGCAGCAGCCGCTGGCAAGTGTGGCTCATCGCAGCGTGGCAAGCCTGGTGCTCGTGCTGGTGCCG
CTTCTGTGCTGGCTTGGGGTGCTGCGCACGCGCTTTCGCCGCCTGCAAGCGGAGCGCCGGCAGGCACTGG
CCGCCGAACAGGATGTCGCGCTACCGTTCGTGCAGGCGCAAGAGCGGGCCTTGAGCCAGGGGCTTGAGCG
GTATCTCGACAATGCCGGTGGGCGACGCGCGTTGTACCGGCTGCCTTGGTACCTGGTGTTGGGCGACGAA
CAGGCCGGTAAAAGCAGCTTCATCGACCGCACCGATCAGCGCTTTACCCTGACGCGTATCGACCAGGCCC
AGGCACGGGGCCGACAGGCTGAAGCACTGGCCTATCCGGTAGGCTGGTGGGTCAGCGACGATGCCGTGAT
CATCGACCCGCCCGGCGTTTTCATCAGTCAAAAACCACCGGTGGGCTCGGCGGCCAACGACCCCACCAAT
GCCTCCTCGCCGCCCGGTATCCAGGCCCGGTTATGGGAGCACCTGTTGGGCTGGCTGCAGCGTAAGCGAA
GCCAGCGGGCGCTCAATGGTGTGTTGCTGGTGGTCGACCTGCCGGCGCTGCTGCATGGCAAGCCCGAGCA
GCGCGTCGCGCTGGCCCATGGGTTGCGCACACGCCTGTACGAAGTGAGCAGTCAGTTGGGCGCGCGCCTG
CCGCTGTACGTGGTTCTGACCAAATTCGATCTGCTGGACGGCTTCGACCAGTTCTACAGCCAGCTTCCGG
CCGCCAAGCGTGAAAGCCTGTTGGGGTTCACCTTCAAGCTGGATGCGGTTGACGCGTTCGACGCCTGGCT
GGATGAGTATGACGAGCACTACGGGCGGCTTCTCACCCAATTGCATGAGCAGGTCATCGATCGGCTGGAT
GTACTGGGCAAGACAGCACCGTGCGTGCGCCTGTTCTCACTGCATGCACAGCTGATCGGGTTGCGCCCCA
TACTGCAGGCATTCTTGCGCGAAACCCTGGCGAGTGACCGGTTCACCACGCCACCCTTGGTGCGTGGTGT
GTACTGGTCGTCAGTGGTACAGCAAGGCGACATGCGCAATGCCTTTGTCCGTGAAGCGGCTCAGCCCTAC
ACGACGAAGCTACCCCTGCGTGAAGGTAAGGCACAGGGGAAGGCGTTGGTCTATTTCATCCAGCAAGCAT
TCAGGCGGGTTATTTATCAGGAAGCCGGGCTGGCGGGCGACAATGTTCGGGTTGCGCGCAGCAAGCGCCA
CTTGCTGTGGGTGGGCTCTGGTGTAGGCATCCTGGCGTTCAGTATCGCCATTGCCAGCTGGCAGCGTTAC
GCCGAGATCAATGGCGCCAAGGCTGCCAGTGTGCTCGCCAAAAGCCAGGAGTACAGTGGTCACGAAGTCG
ATATGCGTCTTGATCCGACCGGGCGCAACCTGCTGGCGCCACTGGACCAGATTCGCGATGCGGTGGCGGT
GTTTGGCGACTATCGTGCGGCCTGGCCGGTGGTTGCCGATTTTGGCTTGTATCAAGGGCGCAACATTGGT
CCCTTGGTTGATGAGGCGTACCTCAGCTTGTTGTCGAAACGTTTCTTGCCGGCCTTGGCCAGTGGTGTGA
TCGATGCCATGAACGCTGCACCACCTGGCAGTGAGCAACAAATGGCCGCGCTCAGGGTTTACCGGATGAT
CGAGGACCGCAACAGCCGCCGGCCAGAATGGGTCGAGGGCTGGATGGCCCGTCAGTGGCAACGGGCCTTT
CCTGGCCAGGGTCAGTTGCAGCGTGACCTCATGCAGCACCTGAAGTACGCCTTGGCCTATGCCGATACCG
ATTTGCCGCAATACCGCCAGCGGGTCAGCGAAGTGCAGCAGGTGTTGCGCAAATTGCCGTTGCCACAGCG
GGTCTACGCAGGGCTGAAACAACAATCGTACGAGCAGGTGCACGCCGGGCTGGACCTGCGCCACCAGGTA
GGGCCTGCGTTCGATGTGGTGTACCAGCCGTCTTCCGGGTCAAGGCAAGGGGGGGAGGATGTAAGGCTGG
CCGGCATGCTCACCGCCAAAGGCTTCAGGGATTACTTCGAGCCGCACAGCCAACGCTTCGCTGAAATGGC
GATGGTTGATCAATGGGCATTGGGGGAGCGCAGTCAACTCGACTATTCGGACGTCGACCGCGATGCGTTG
ACCGAGCGGCTGTATAACCTCTACAGCGCCGATTACATTGACAGCTGGCGGCGCGCCCTGAACGCGTTTA
CGGTGGCTGACTTCCGTGATCTGGACCATGGTGTCGCGATCCTGGAGCAGTTGACCGGCCCCGCAGCACC
GTTGCAACGGCTGCTGGATACGGTCAGGGATAACACCTCGCTTGCGTCTCCAGCAGTTGTTGAATCACCG
GGTGAGCTGAGTACGCTGCGGGTAGCAACCGGAAAACCCGAGCAACCGCAAGCGTTGGCCATCCAGCGGG
CGTTTGCAGGCCTGGGCGCCATGCTGCAGGCGACAGGAGAAAAGCCGAGCTACTACGATGAAACCCTTGG
CGCTGTTGCGGCCGTGCTGGACTACGCCAAGGCCGTACAGGACAGCCCGGACCGCGGCAAGGCCGCGTTG
CAAGCCGTGCATCAGCGCTTTGCGATGACAGGGCAGGACCCGATCGGTACCCTGCAACGTGTTGCCACAG
GTTTACCGGAGCCTATCAGCCACCAGGTCAGAAAGCTCGCCGACCAGACTGCCCAGGTGCTGAACGTTGA
AGCACTGCGCGAACTGGAGCGACGTTGGGATGCTGACGTGTACAGTTTTTTCCAGCAACGCCTGGCAGGC
CGCTACCCCTTTGTGGTGAAGGCACCCGATGCTTCTTTGGATGACTTCGAGGCGTTCTTCGGGCCGAAAG
GGCGCCTGCAGCAGTTTAATGATCGGTATCTCAAGGTTTTCCTGAAGGACAACCTTGAAGCTTTGCAGTC
CGCTCAGCACGGGCAATCCCTGATTCGTGCCGACGTGATCGAGCAGCTCGAGCTGGCGGAGCGCATCCGC
GAAACCTTCTTCGATCAGCGTGGCAAGCTGAGTGTGCAGTTCAGCATCGAGCCCTTGGGGCTCAGTGCGA
ACCAGCGTACCAGCCTGCTGGACCTGGATGGCCAGTTGATTGCCTACACCCATGGCCCAAGCCATATCAC
GGGTATTGTCTGGCCCAATACCCTGGGGCAGCAGGTCCGTAGCAATCTCACCTTGCTAAGGCAAAATGGC
AACAGCAGCAGCCTGGAGTACCGTGGCCCGTGGTCGATGTTCCGCTTGCTCAGCCGCGGCGCGCTCAATG
GCCGGACGGCGACCAGCGTGGACCTGAGCTTCCGGACCGGAGATGGCGTGATGCGCTATCGGCTTAACGC
TGAAAAAGCCTTCAATCCTATTACCCAGCAACCGTTCAAAGGCTTCCGCTTGCCCCGAGGCTTATTGCAA
CAGCCAGCCAATGGGGTGCAGGCGGCGCTATCGGATGAGCAGCGACTATGA
 Primer design