SecReT6
Protein ID: 395449298
SecReT6 ID668
T6SS typei4b
Gene symbol-
Locus tagYSA_10450
StrainPseudomonas putida ND6
Repliconchromosome [GenBank: NC_017986] [Browse all T6SS(s) in this replicon]
Location [Strand]5582413..5584908 [-]
ProductOmpA/MotB domain-containing protein
NoteTssM
UniProt IDI3V3W5
KEGG IDppi:YSA_10450
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 2.50E-67, Aligned region: 90..111
ImcF-related_N [PF14331], Evalue: 2.50E-67, Aligned region: 189..453
OmpA [PF00691], Evalue: 5.40E-16, Aligned region: 716..810
IcmF-related [PF06761], Evalue: 1.30E-09, Aligned region: 94..133
IcmF-related [PF06761], Evalue: 1.30E-09, Aligned region: 497..637
Protein Sequence: 831 a.a.     [Download]
>gi|395449298|ref|YP_006389551.1| OmpA/MotB domain-containing protein [Pseudomonas putida ND6]
MNKLKYYCLRYQPYLLGVAFFLAIFLVWAIGRAFGFASLHSLLAGIGVFLLLSAGYVLLLYRGVGQHHNL
EGLLRDDADQAVLSAAPADREEVSLLRERLLQGIERLHSNKPRGTSNKDALYALPWYLVIGQPAAGKSTM
ILQSGLNFPYAEREGVRVAGLGGTRNCDWFFSSEAVLLDTAGRYMNSPEEAGKWRGFLQLLRQHRQRRPL
NGLIVSVSIADILHGSVEDQERVAKRLRERIQESCALLEVRLPIYLVFTKCDLIPGFTAFYRQLDDAARG
EVMGKTFSHKGYEQADWGQRFSNAMDELTRYWGQMASQQLVQQDIQVTRRNDAAYRFPLELAALKPRLHQ
FVDSLLRANPYQNAEMLRGFYFTAALQADEAQWGCHGQHVAERFALEHAEGTGTAGSQPAPLFINSLFRK
VIIPDQHLVALYTSNHRERRRKAGWVGAAGLAALVLCSLWGWSYLNNRATLASIADELAQAKADDQAASG
QYTAWRSLDRLRFWAAHYHEQHHAKGVPLSMRLGLYQGHEVEPLLRNRYFATLQNVMLKPTADNLTRTLY
LLTTLKVYQRNTRELQPVSGIDSVEAEALPHDNRAQSIANFGKAALDTYVMLSPGQREHADPAFLKAHLP
DYWYPAIARHTGKSMAAAGSEAGGNQDYLYASRQITFYSDQIREPDVPRILDNAFLMSSSRNYIDSLRAQ
SLRAIETITLESDTLFAFGRADFQSLKNEGQHQLSAIASKLLNTPNIGKIIISGHADQLGDSQGNLQVSK
QRAQTIRTYLVGKGVPAELVVAQGEGSRKPLVNCDMQQPRTQLIKCLEPNRRVEIEVRGLN
 
Nucleotide Sequence: 2496 bp     [Download]
>gi|395443650|ref|NC_017986.1|:c5584908-5582413 Pseudomonas putida ND6 chromosome, complete genome
ATGAACAAGCTCAAGTACTACTGCCTGCGCTACCAACCCTACCTGCTGGGCGTGGCATTCTTCCTGGCGA
TCTTCCTGGTCTGGGCCATCGGCCGAGCCTTCGGCTTCGCCTCGCTGCACAGCCTGCTGGCCGGGATCGG
CGTGTTTCTGCTGCTGTCGGCGGGCTATGTACTGCTGCTGTACCGCGGCGTGGGTCAGCACCACAACCTT
GAAGGCCTGCTGCGCGACGACGCCGACCAGGCCGTACTCAGTGCAGCCCCGGCCGACCGGGAAGAAGTCA
GCCTGTTGCGCGAGCGCCTGCTGCAGGGCATCGAGCGCCTGCACAGCAACAAGCCGCGCGGTACTTCGAA
CAAGGATGCCCTGTATGCCCTGCCCTGGTACCTGGTCATTGGCCAGCCTGCCGCCGGCAAGAGCACGATG
ATCCTGCAGTCGGGCCTTAACTTCCCCTATGCCGAGCGCGAAGGCGTGCGTGTCGCGGGCCTGGGCGGCA
CGCGCAACTGCGACTGGTTCTTCAGCTCTGAAGCGGTACTGCTGGACACTGCCGGGCGCTACATGAACAG
CCCCGAGGAAGCCGGCAAGTGGCGCGGCTTTTTGCAACTGCTGCGCCAGCACCGCCAGCGCCGTCCCCTT
AATGGCTTGATTGTCAGCGTCAGCATCGCCGATATCCTGCATGGTTCGGTCGAAGACCAGGAGCGCGTGG
CCAAGCGCTTGCGCGAACGCATTCAGGAAAGCTGCGCGCTGCTGGAAGTGCGTCTGCCAATCTACCTGGT
TTTCACCAAATGCGACCTGATCCCTGGTTTCACCGCGTTCTATCGCCAACTGGACGACGCGGCTCGTGGT
GAAGTGATGGGTAAAACCTTCTCTCACAAGGGTTACGAGCAAGCCGACTGGGGCCAGCGCTTCAGCAATG
CGATGGACGAGCTGACGCGTTACTGGGGGCAGATGGCGAGCCAGCAGCTGGTGCAGCAGGACATACAAGT
CACCCGGCGGAACGACGCTGCCTACCGCTTCCCGCTGGAGCTGGCCGCGCTCAAGCCGCGCCTGCATCAG
TTCGTCGACAGCCTGCTGCGTGCCAACCCTTACCAGAATGCCGAAATGCTGCGCGGTTTCTATTTCACCG
CGGCGCTGCAGGCCGACGAGGCTCAGTGGGGCTGCCACGGCCAGCATGTGGCCGAACGCTTCGCGCTCGA
ACACGCAGAAGGAACGGGCACTGCCGGCAGCCAGCCGGCGCCGCTGTTCATCAACAGCCTGTTCCGCAAA
GTGATCATTCCCGACCAGCATTTGGTGGCGCTGTACACCAGCAACCACCGTGAACGCCGGCGCAAGGCCG
GGTGGGTGGGCGCTGCCGGCCTGGCGGCACTGGTGCTGTGCAGCCTGTGGGGCTGGTCGTACCTGAACAA
CCGCGCCACCCTGGCCAGCATTGCCGACGAACTGGCCCAGGCCAAGGCCGACGACCAGGCGGCCAGCGGC
CAGTACACCGCCTGGCGAAGCCTCGACCGCTTGCGCTTCTGGGCTGCTCACTACCATGAGCAACACCACG
CTAAGGGCGTGCCCCTCAGCATGCGCCTGGGCCTGTACCAGGGCCATGAGGTCGAGCCGCTGCTGCGCAA
CCGCTACTTCGCCACGCTGCAGAATGTAATGCTAAAGCCCACGGCCGATAATCTGACCCGTACCCTGTAC
CTGCTGACCACGCTCAAGGTCTACCAGCGCAACACCCGTGAGCTGCAGCCAGTGAGCGGCATTGACAGCG
TAGAGGCCGAGGCGCTGCCCCATGACAACCGCGCCCAGTCGATCGCCAATTTCGGAAAGGCGGCCCTGGA
CACTTACGTGATGCTTTCTCCGGGCCAGCGCGAGCATGCCGACCCGGCGTTTCTCAAGGCGCACCTGCCG
GACTACTGGTACCCGGCCATCGCCCGCCATACCGGCAAAAGCATGGCCGCCGCCGGCAGCGAGGCCGGTG
GCAACCAGGACTACCTGTATGCCAGCCGCCAGATCACGTTCTACAGCGACCAGATCCGTGAGCCAGATGT
ACCGCGCATCCTCGACAACGCCTTCCTGATGTCCAGTTCGCGCAACTACATCGACAGCCTGCGGGCCCAG
TCACTGCGTGCCATCGAGACCATCACGCTGGAGTCCGACACCCTGTTCGCCTTCGGCCGCGCCGACTTCC
AGAGCCTGAAAAACGAAGGCCAGCATCAGCTGAGCGCAATTGCCAGCAAGCTGCTGAACACCCCGAATAT
CGGCAAGATCATCATCTCGGGGCACGCCGACCAACTGGGTGACAGCCAGGGCAACCTGCAGGTTTCGAAA
CAACGGGCGCAAACCATCCGCACCTATCTGGTTGGCAAGGGCGTACCTGCCGAGCTGGTGGTCGCGCAGG
GCGAAGGCAGCCGCAAGCCATTGGTCAACTGCGACATGCAACAACCGCGAACGCAGTTGATCAAGTGCCT
GGAGCCCAACCGCCGGGTGGAAATCGAAGTGCGTGGGCTTAACTGA
 Primer design