SecReT6
Protein ID: 395449300
SecReT6 ID668
T6SS typei4b
Gene symbol-
Locus tagYSA_10455
StrainPseudomonas putida ND6
Repliconchromosome [GenBank: NC_017986] [Browse all T6SS(s) in this replicon]
Location [Strand]5585810..5589613 [-]
ProductImcF domain-containing protein
NoteTssM
UniProt IDI3V3W7
KEGG IDppi:YSA_10455
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 5.00E-60, Aligned region: 181..435
IcmF-related [PF06761], Evalue: 3.00E-45, Aligned region: 491..555
IcmF-related [PF06761], Evalue: 3.00E-45, Aligned region: 635..878
DUF1215 [PF06744], Evalue: 2.70E-23, Aligned region: 317..343
DUF1215 [PF06744], Evalue: 2.70E-23, Aligned region: 780..821
DUF1215 [PF06744], Evalue: 2.70E-23, Aligned region: 1011..1126
AAA_16 [PF13191], Evalue: 0.0002, Aligned region: 112..258
AAA_16 [PF13191], Evalue: 0.0002, Aligned region: 459..459
AAA_16 [PF13191], Evalue: 0.0002, Aligned region: 881..939
Protein Sequence: 1267 a.a.     [Download]
>gi|395449300|ref|YP_006389553.1| ImcF domain-containing protein [Pseudomonas putida ND6]
MKTLLRLLKSFWVLLPLLWLASLLICWLAAPLVPWLRHHVPEALAIISACFLLVIVLRQYQRIRAEHNLE
NLLQIEVDRSWNATGEFRDQQVLRERLKHAIAMLRTDRSAGGGGKAALSDLPWYLVVGMSAAGKTSLLTH
SGLSASIATANDSESGTQHCDWYFSPDAVMIDTAGRYLRDDQSASEFSAFLRMLRKQRGKAAINGLVLVV
SLPELLAANSDERNALAAQLVARVEEYAECLDANPPVYLMLSKTDQLPGFSQAFDGLDLHERQQPLGMTF
GLSEIRTNGLHAVLQTRLKKLQAHIRQHVDAQMIALGAEADSTLLNFPQYFAALSGVLEQFLDHFTRGHR
GGAPLLLRGLYFTSALQNGQQLGQVYEDVIADEFALQAAYDEQAGHVGKALGNRSYFITDTFRQVIFPDR
DLILYQSRLGRQAAFSPLLLGLAAATGLLFIGWQALSFANNRQWLDSLRGQLAHIEQAADREQQLAAGKG
LEVLREQMANVEAHRLQGVPLQLGGGLYQGEAIHQVTRSAYLAQLRSQALEPIARSLQVQMRAFNTFANG
INQELEFTPAPQPKKRNGKPLAPAIAARAQAALGNTRAGAYAAKVNLATASDGAELSAATGGLSLSEEML
GRLDEQQVASIIEAYNTLKLYLLLTEPQAHPDPAFVAASLPQAWASAAAEGTPADAGVIAENAPLYVQLL
EQGQAPSLPRNEQLINETRQNLKSFMISSSLVDREYLRLQLESSRQFPALSLNDLVPQPGRTLLYGTAGV
PAIYTRQGWDTFVKPELIKLVSGNLRNESDWVLDGEGGDAIVQKANFVREFMTRYKRDYTQAWYKMVSSV
GVRHFADLASATRELGLLSDVQNSPVKNLLQAVNDNTQWDLPVKQAIPAPGTSRDDGFWSKVTGLFDAND
TLPANVAPALPAVDDGSLAKRFEPVARVFAENNAEGADSTIMDRYLAALRKLKVRMNNIQRSQDVGKSSK
QLISETLEGQPSEITTVRNYVESSVDTSQDGLSRSLQGLFSLPIQYAWATLRDPAGEQIAKAWAQQIAKP
WEQVMAHRYPIAGSSRNEASVKDLQRFVDPDSGLLPAFKRNEIGNLAGGEGLGVGDGKGPALVNPGMLNS
IDKASSVGQVIASLSDRDNGFEIMLEPSANFTDIVFTLDGQEQHYRNGRSSWNRFAWPGTSTAPGARLDV
VTLSGTRVTVFDFPGRWGLLRMNESARVDDLDGIQQRFSWNTASGRVSLIVRNFGGVKLTDLGDVKALSA
LNSRGAQ
 
Nucleotide Sequence: 3804 bp     [Download]
>gi|395443650|ref|NC_017986.1|:c5589613-5585810 Pseudomonas putida ND6 chromosome, complete genome
ATGAAAACATTACTGCGTCTGTTGAAAAGTTTCTGGGTGCTGCTGCCATTGCTGTGGCTGGCTAGCCTGT
TGATTTGCTGGCTGGCCGCGCCGCTGGTGCCGTGGCTGCGTCATCACGTGCCTGAAGCGCTGGCAATCAT
CAGTGCCTGCTTCCTGCTGGTAATCGTGCTGCGCCAATACCAGCGCATTCGTGCCGAACACAACCTGGAG
AACCTGCTGCAGATCGAGGTCGACCGCTCGTGGAATGCCACTGGCGAGTTCCGTGACCAGCAGGTGCTGC
GTGAGCGCCTGAAGCACGCCATCGCCATGCTGCGCACCGACCGCTCCGCGGGTGGCGGCGGCAAGGCGGC
CCTGTCCGACCTGCCCTGGTACCTGGTGGTTGGCATGTCGGCGGCCGGCAAGACCTCGCTGCTGACCCAT
TCCGGCCTGTCGGCCAGCATCGCTACGGCCAACGACAGCGAAAGCGGCACCCAGCACTGCGACTGGTACT
TCAGCCCCGACGCCGTGATGATCGACACCGCCGGGCGCTACCTGCGCGACGACCAGTCGGCCAGCGAGTT
CTCGGCCTTTCTGCGCATGCTGCGTAAGCAGCGCGGCAAAGCGGCGATCAATGGCCTGGTGCTTGTGGTC
AGCCTGCCCGAGCTGCTGGCGGCCAACAGCGATGAGCGCAATGCCCTGGCGGCCCAGTTGGTGGCACGGG
TGGAAGAATACGCCGAATGCCTCGATGCCAACCCGCCGGTTTACCTGATGCTGAGCAAGACCGACCAGTT
GCCGGGTTTCAGCCAGGCTTTCGACGGCCTCGACCTGCACGAACGCCAGCAGCCGCTGGGCATGACCTTT
GGCCTTTCGGAAATCCGCACCAACGGCCTGCACGCCGTGCTGCAGACACGCCTGAAGAAGCTGCAGGCTC
ATATTCGCCAGCACGTCGACGCGCAGATGATCGCCCTCGGTGCCGAAGCCGACAGCACCCTGCTGAATTT
CCCGCAGTACTTCGCCGCCCTCAGCGGTGTGCTCGAGCAATTCCTCGACCACTTCACCCGCGGCCATCGC
GGCGGTGCCCCGCTGCTGCTACGTGGCCTGTACTTCACCAGTGCACTGCAGAACGGGCAGCAACTGGGGC
AGGTCTATGAAGACGTCATCGCCGACGAATTCGCCCTGCAGGCCGCCTACGATGAACAGGCCGGGCACGT
CGGCAAGGCCCTGGGCAACCGCAGCTACTTCATCACCGACACCTTCCGCCAGGTGATCTTCCCCGACCGC
GACCTGATCCTTTACCAGTCGCGCCTGGGCCGCCAGGCTGCGTTCAGCCCGCTGCTACTGGGCCTGGCCG
CCGCCACCGGGTTGCTGTTCATCGGTTGGCAAGCGCTGTCGTTCGCCAATAACCGCCAGTGGCTGGACAG
CCTGCGCGGGCAGCTGGCGCACATCGAACAGGCAGCAGACCGCGAGCAGCAGCTGGCCGCAGGCAAGGGC
CTGGAAGTGCTGCGTGAACAGATGGCCAACGTCGAGGCCCATCGCCTGCAGGGAGTGCCCTTGCAGTTGG
GTGGCGGCCTGTACCAGGGCGAGGCGATTCACCAGGTGACCCGCAGCGCCTACCTGGCGCAGCTGCGCAG
CCAGGCGCTGGAACCGATCGCACGCAGCCTGCAGGTGCAGATGCGGGCGTTCAACACCTTCGCCAACGGT
ATCAATCAGGAGCTGGAATTCACCCCGGCCCCGCAGCCGAAGAAGCGCAATGGCAAGCCGCTGGCCCCTG
CCATTGCGGCCAGGGCCCAGGCCGCGCTGGGCAACACCCGCGCTGGCGCCTATGCCGCCAAGGTCAACCT
GGCCACTGCCAGCGATGGCGCCGAGCTGTCCGCCGCCACCGGTGGGCTGTCACTGTCCGAAGAAATGCTC
GGGCGCCTGGACGAGCAGCAGGTGGCCTCGATAATCGAGGCCTACAACACCCTCAAGCTGTACCTGTTGC
TGACCGAGCCACAGGCCCATCCAGACCCGGCCTTCGTCGCTGCCAGCCTGCCCCAGGCGTGGGCCAGCGC
CGCCGCCGAAGGCACCCCGGCCGACGCTGGCGTGATCGCGGAAAATGCCCCGCTGTACGTGCAGTTGCTG
GAACAGGGGCAGGCGCCGTCGTTGCCGCGCAACGAACAGCTGATCAACGAAACCCGGCAGAACCTCAAGT
CGTTCATGATCTCCAGCTCGCTGGTCGATCGCGAGTACCTGCGCCTGCAGCTCGAGTCGAGCCGGCAGTT
CCCGGCGCTGAGCCTCAACGACCTGGTCCCGCAACCAGGCCGCACGCTGCTGTACGGAACCGCGGGTGTG
CCGGCGATCTACACCCGCCAGGGCTGGGACACCTTCGTCAAGCCCGAGCTGATCAAGCTGGTGTCGGGCA
ACCTGCGCAACGAGTCGGACTGGGTGCTGGACGGCGAAGGCGGCGATGCCATCGTGCAGAAGGCCAACTT
CGTACGCGAGTTCATGACCCGCTACAAGCGCGACTACACCCAGGCCTGGTACAAGATGGTCAGCAGCGTT
GGCGTGCGCCACTTCGCCGACCTGGCCTCGGCGACCCGGGAACTGGGGCTGTTGAGCGACGTGCAGAACT
CGCCAGTGAAGAACCTGCTGCAGGCCGTCAACGACAATACCCAGTGGGACCTGCCGGTCAAGCAAGCCAT
CCCGGCCCCCGGCACCAGCCGCGATGACGGTTTCTGGAGCAAGGTCACCGGTCTGTTCGACGCCAACGAC
ACCCTGCCTGCCAACGTCGCCCCGGCCCTGCCGGCGGTGGACGACGGCAGCCTGGCCAAGCGCTTCGAGC
CGGTGGCGCGGGTGTTCGCCGAAAACAACGCCGAAGGTGCCGACAGCACCATCATGGACCGCTACCTGGC
CGCCTTGCGCAAACTCAAGGTGCGCATGAACAACATCCAGCGCTCGCAGGATGTGGGCAAGAGCAGCAAA
CAGTTGATCAGCGAGACCCTGGAAGGCCAGCCGAGCGAGATCACCACCGTGCGCAACTACGTGGAAAGCA
GCGTCGACACCAGCCAGGATGGCCTGTCGCGCTCGCTGCAGGGGCTGTTCAGCCTGCCCATCCAGTATGC
CTGGGCGACCCTGCGCGACCCGGCCGGCGAGCAGATCGCCAAGGCCTGGGCGCAGCAGATCGCCAAGCCC
TGGGAGCAGGTCATGGCACACCGTTACCCGATTGCCGGCAGCAGCCGCAACGAGGCTTCGGTGAAAGACC
TGCAACGGTTCGTGGATCCCGACAGCGGCCTGCTGCCGGCGTTCAAGCGCAACGAAATCGGCAACCTGGC
CGGTGGTGAAGGTCTGGGTGTGGGCGATGGCAAGGGGCCGGCGCTGGTCAACCCTGGCATGCTCAACAGC
ATCGACAAGGCCAGCTCCGTGGGCCAGGTGATCGCCAGCCTGTCGGACCGTGACAACGGCTTCGAAATCA
TGCTGGAGCCTTCAGCCAACTTCACCGACATCGTCTTCACCCTCGATGGCCAGGAGCAGCACTACCGCAA
CGGCCGCAGCAGCTGGAACCGCTTCGCCTGGCCGGGCACCAGCACCGCGCCGGGCGCGCGCCTGGACGTC
GTCACCCTGAGCGGCACACGGGTCACCGTGTTCGATTTCCCAGGGCGGTGGGGCCTGCTGCGCATGAACG
AGAGCGCTCGGGTCGACGACCTGGACGGCATTCAGCAACGCTTTAGCTGGAACACCGCCAGTGGCCGCGT
AAGCCTTATTGTGCGCAACTTCGGCGGGGTCAAGCTCACCGATCTGGGTGACGTCAAGGCCCTGAGCGCC
CTCAACAGCAGGGGCGCGCAATGA
 Primer design