SecReT6
Protein ID: 397657651
SecReT6 ID677
T6SS typei2
Gene symbol-
Locus tagA225_2638
StrainKlebsiella oxytoca E718
Repliconchromosome [GenBank: NC_018106] [Browse all T6SS(s) in this replicon]
Location [Strand]2786745..2789978 [+]
Producthypothetical protein
NoteTssM
UniProt IDI6X257
KEGG IDkoe:A225_2638
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 3.00E-70, Aligned region: 354..672
IcmF-related [PF06761], Evalue: 3.00E-70, Aligned region: 752..773
DUF1215 [PF06744], Evalue: 6.20E-37, Aligned region: 795..915
ImcF-related_N [PF14331], Evalue: 0.0062, Aligned region: 114..165
ImcF-related_N [PF14331], Evalue: 0.0062, Aligned region: 237..262
Protein Sequence: 1077 a.a.     [Download]
>gi|397657651|ref|YP_006498353.1| hypothetical protein A225_2638 [Klebsiella oxytoca E718]
MGAVFLTSLLSVLIFFLIPFQKNDTPLTPQYSRPAGEGAGTQERDISLSSLKKHLRRRYNLFWRSKVRLL
LVCGEPEHIAAIAPGLAEKQWLEGHRTVLIYGGSLSSAPDTGRLTALRKLRRSRPLDGIVLALDERQTTA
GTLDNHLRALEQVGEALRWQPPVYLWQVTDSDWSQDARVTQTVGALFPARATPAGVERQLRAILPSLRER
GMQQLCAGPSHDFLLRFGRQLEKQGIAHWKTLLTPWLTEHLKRVPLRGLMFSPSLAPEDNAAGHEHRWSA
PAIWQGVTADCAQARGVRVGMPWQRTPGVTLLTLIALWGAGSVVSFAVNRHHIVSAAARAQQLVNHPAVN
DPQLMALQALRNDIGRLQTQQANGAPWYQRFGLDHNAPLSAALMPWYGQASNRLIRDAAMQALTQKLTVL
ANLPPRSPQRATLAKAGYDQLKAYLMMARPDKADAALYAQVMTTTAPSRPGLSPALWQSIAPDLHAFYMQ
SLPSQPAWKITPDRQLVTRVRQVLLEQIGRRNAESTLYENMLTRVRRSYADMTLEDMTPQTDAGRLFSTP
ESVPGMFTRQAWEGGVQEAIDNAVASRRDEIDWVLSDSRKTLSGDVSPEALKQRLTARYFTDFAGAWLNF
LNSIRLNPAHNIADVTDQLTLAGDVRQSPLIALMNTLAYQGQTGQQKEAISASLVKSAKNLLGGDDRPVI
DQQAAGPAGPLDSTFGPLLQLMGKNSAQSVMAADSSLSLQTYLTRLTRVRLRLQQVANAADPQAMMQQLA
QTVFQGRSVDLTDTQEYGSLVAASLGEEWSGFGQTMFVQPLTQAWETVLQPSAASLNEAWQRSVVANWNS
AFKGRYPFAAAKSDASLPMLAAFIRRDTGRIDRFLSTQLGGVLHREGSTWVADRTHSQGLTFSPAFLNAV
NQLSQLSDILFTDGSQGISFELQGVAMPEVVETQLTLDGQKLHYFNQVADWQSFRWPGVINKPGAMLTWT
STAAGTRLYTNHSGPWGVIRMLEQMQRQKAGDGLYRLSVTAPDRRQLQWLLRTELGDGPLALLKLRNFSL
PSQIFSVGVPAPGRTDEYESDVVEGSE
 
Nucleotide Sequence: 3234 bp     [Download]
>gi|397655102|ref|NC_018106.1|:2786745-2789978 Klebsiella oxytoca E718 chromosome, complete genome
TTGGGTGCGGTTTTTCTGACCAGTCTGTTGAGCGTGCTGATTTTTTTTCTTATCCCTTTCCAAAAAAACG
ACACCCCGCTGACTCCGCAGTACAGTCGCCCGGCAGGCGAGGGGGCTGGTACACAGGAACGAGATATCTC
CCTTTCTTCGCTAAAAAAGCACCTCCGCCGCCGCTACAACCTCTTCTGGCGCAGTAAGGTCCGCCTGCTG
CTGGTCTGTGGCGAACCCGAACATATCGCCGCCATCGCCCCCGGCCTTGCCGAAAAACAGTGGCTTGAAG
GCCACCGCACGGTGCTGATTTACGGCGGCAGCCTGTCATCGGCGCCGGACACCGGGCGCCTGACCGCCCT
GCGTAAGCTGCGCCGCAGCCGTCCGCTGGACGGCATCGTGCTGGCGCTGGATGAGAGACAGACCACCGCC
GGTACGCTGGATAACCATCTTCGCGCCCTGGAGCAGGTCGGGGAGGCGCTGCGCTGGCAGCCGCCGGTGT
ACCTGTGGCAGGTGACTGACAGCGACTGGTCGCAGGATGCGCGCGTCACCCAGACGGTAGGGGCGCTTTT
CCCGGCCCGCGCCACGCCGGCGGGGGTGGAGCGCCAGCTCCGCGCTATCCTGCCATCCCTGCGCGAAAGG
GGAATGCAGCAGCTGTGCGCCGGGCCGTCGCACGATTTCCTGTTACGTTTCGGCCGGCAGCTGGAGAAAC
AGGGAATAGCCCACTGGAAAACGCTGCTGACGCCGTGGCTGACGGAGCACCTGAAGCGTGTTCCGCTGCG
CGGCCTGATGTTCAGCCCGTCGCTGGCCCCTGAGGATAATGCCGCGGGCCATGAACACCGCTGGTCCGCT
CCGGCGATCTGGCAGGGCGTGACGGCGGACTGCGCTCAGGCGCGGGGCGTGCGGGTAGGGATGCCGTGGC
AGCGAACGCCGGGCGTCACCCTGCTGACGCTGATTGCCCTGTGGGGGGCGGGCAGCGTGGTCTCCTTTGC
CGTTAACCGCCACCATATCGTCAGCGCGGCGGCGCGGGCGCAGCAGCTGGTGAATCATCCCGCGGTTAAC
GACCCGCAGCTGATGGCGCTGCAGGCTCTGCGTAACGATATCGGGCGCCTGCAGACGCAACAGGCGAATG
GCGCTCCCTGGTACCAGCGCTTCGGGCTGGACCACAATGCGCCGCTTTCAGCCGCCCTGATGCCCTGGTA
CGGCCAGGCCAGTAACCGCCTGATACGCGATGCGGCCATGCAGGCGCTGACGCAGAAACTGACTGTCCTG
GCGAACCTGCCGCCGCGCAGCCCGCAGCGCGCCACGTTAGCTAAGGCGGGCTACGATCAGCTGAAAGCAT
ACCTGATGATGGCGCGCCCGGACAAAGCCGACGCTGCCCTGTACGCGCAGGTGATGACAACCACCGCGCC
ATCCCGGCCGGGACTCTCCCCGGCGCTGTGGCAGAGTATCGCCCCGGACCTTCACGCCTTTTACATGCAG
AGCCTGCCGTCGCAGCCTGCCTGGAAAATCACGCCGGACAGGCAGCTGGTCACCCGGGTACGTCAGGTGC
TGCTGGAGCAGATTGGCCGGCGCAACGCGGAAAGTACGCTGTATGAGAACATGCTCACCCGGGTGCGCCG
CAGCTACGCGGACATGACGCTGGAGGACATGACGCCGCAGACCGACGCCGGTCGCCTGTTCAGCACGCCG
GAGTCGGTGCCGGGGATGTTCACCCGCCAGGCGTGGGAGGGCGGGGTTCAGGAAGCCATTGATAACGCCG
TGGCGTCCCGGCGCGATGAAATCGACTGGGTGCTGAGCGATAGCCGTAAAACGCTGTCCGGCGACGTCTC
ACCGGAGGCGCTGAAGCAGCGCCTGACGGCGCGCTACTTCACCGATTTTGCCGGTGCCTGGCTGAACTTC
CTCAACAGTATCCGGCTGAACCCGGCGCACAATATTGCCGACGTCACCGACCAGTTAACGCTGGCCGGGG
ACGTGCGCCAGTCGCCGCTGATTGCCCTGATGAACACCCTGGCTTACCAGGGGCAGACCGGGCAGCAGAA
AGAGGCCATTTCCGCATCGCTGGTGAAATCGGCGAAAAACCTGCTGGGCGGTGATGACCGGCCGGTGATT
GACCAGCAGGCCGCCGGACCGGCAGGGCCGCTGGACAGCACCTTCGGGCCGCTGCTGCAGCTTATGGGTA
AAAACAGCGCGCAGAGCGTGATGGCGGCGGACAGTTCGCTCAGTTTACAGACTTACCTGACGCGTCTGAC
CCGCGTGCGCCTCAGGCTCCAGCAGGTGGCAAACGCCGCCGACCCGCAGGCGATGATGCAGCAGCTGGCG
CAGACGGTCTTCCAGGGCAGGAGCGTTGACCTGACCGACACGCAGGAGTACGGCAGCCTGGTGGCGGCAA
GCCTCGGTGAAGAGTGGAGCGGTTTCGGGCAGACGATGTTTGTTCAGCCGCTGACCCAGGCCTGGGAGAC
GGTGCTTCAGCCGTCGGCGGCCAGCCTGAACGAAGCGTGGCAGCGCTCAGTTGTCGCGAACTGGAATTCA
GCGTTTAAGGGGCGTTATCCCTTTGCTGCCGCGAAGAGCGACGCCTCGCTGCCGATGCTGGCGGCGTTCA
TCCGCCGCGATACCGGACGTATTGACCGTTTCCTCAGCACGCAGCTGGGCGGCGTTCTGCACCGGGAGGG
CAGCACCTGGGTGGCGGACAGAACCCACAGCCAGGGGTTGACGTTCAGCCCGGCCTTCCTGAACGCGGTG
AACCAGCTCAGCCAGCTGTCCGACATCCTGTTTACCGACGGCAGCCAGGGTATCAGCTTTGAACTGCAGG
GGGTGGCGATGCCGGAAGTGGTGGAAACACAGCTGACGCTTGACGGGCAGAAACTCCACTATTTTAACCA
GGTTGCCGACTGGCAGAGCTTCCGCTGGCCGGGGGTAATCAATAAACCGGGGGCGATGCTGACCTGGACG
TCGACGGCGGCGGGAACCCGTCTGTATACAAACCACAGTGGTCCGTGGGGCGTTATCCGGATGCTGGAGC
AGATGCAGCGGCAGAAAGCGGGGGACGGGCTGTACCGGCTGAGCGTCACCGCGCCGGACAGGCGACAGCT
TCAGTGGCTGCTGCGTACGGAACTGGGCGACGGACCGCTGGCGCTGCTGAAGCTGCGAAACTTCAGTCTG
CCGTCGCAGATATTCAGCGTCGGTGTCCCGGCGCCAGGCCGCACGGATGAATATGAATCTGACGTTGTGG
AAGGGAGTGAATAA
 Primer design