SecReT6
Protein ID: 397658364
SecReT6 ID678
T6SS typei2
Gene symbol-
Locus tagA225_3362
StrainKlebsiella oxytoca E718
Repliconchromosome [GenBank: NC_018106] [Browse all T6SS(s) in this replicon]
Location [Strand]3533797..3537267 [-]
Producthypothetical protein
NoteTssM
UniProt IDI6X0S5
KEGG IDkoe:A225_3362
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 3.40E-72, Aligned region: 431..749
DUF1215 [PF06744], Evalue: 2.00E-35, Aligned region: 872..992
Protein Sequence: 1156 a.a.     [Download]
>gi|397658364|ref|YP_006499066.1| hypothetical protein A225_3362 [Klebsiella oxytoca E718]
MRRFLSLFKKPEIVFWLLVLIVLVCSLAVVSIVYWLPERLQLIRETSAWYAWLSGSVAASIALAITGVFL
FFGARAEGKRSFSKERQNAQGDDVKTPPKKDVTPVSAAVTTRQQIRDHLRRRYHLFWYHKVRLLLITGDE
AAIEQLVPGLQQQQWLEGNRTVLIYGGSLAPEPDREKYTALRKLRRGRPLDGIVRVMPQSLNLAPQISDS
DLRGLEKISELLRYSAPVWLWQLCDSNWSQGMRPEQAVGASFPLRAKEDDIIRQLERMLPALRAQGVSQV
AENNSHDFLLRLGQHLQDGGIVRRAQQLLPWLYDSQQRVPLRGLMFSLPENKSASTSAGTADAEQYIPEL
QRHALTLPATWQGIVDDCTRVRGRRVGMAWERTLAWTLMTIIVVWGAGMLLSFTVNRQQIVSVAEQAHAL
VAHPSVSDNQLTALHTLRNDAGRLQHNAQEGAPWYQRFGLDHNQQLLRAMLPWYGVANNRLIRDPANEAL
KQKLSALANSAPNSDQRAQLAKPGYDQLKAWLMMARPDKADGAFYAQTMKTVQPTRTGISAGLWQSLAPD
LWAFYISELPAQPKWVITPDAQLISQSRQVLLQQIGRRNAESTLYENMLKSVRRNFADVSLEDMTGGTDA
RRLFTTEEVVPGMFTRQAWDGGIQQAIEKAANSRRDEIDWVLSDSRKAVSSDLSPEALKARLTQRYFTDF
AGSWLSFLNSLQLNPANNIADVTDQLTLMSDVRQSPLIALMNTLAWQGQTGQQSEGLSDSIIKSAKDLVG
GKDKPVIDQSASGPQGPLDETFGPLLQLLGKNKGSNVMSADNTLSLQTYLTRITRVRLRLQQVASASDPQ
AMMQTLAQTVFQGKSVDLTDTWQYGSLISASLGEEWSGFGSTMFVQPLTQAWETVLQPSAASLNDKWSRS
VVANWQTAFDGRFPFAASKSDASLPMLAEFVRKDSGRIERFLTTELSGVLHKEGSQWVPDKVNSQGLSFN
PAFLRAINQLSQLSDILFTDGNQGITFELQARPVPQVVETQLTIDGQKLHYFNQMADWQSIRWPGDTYKP
GTMLTWTTVNAGARLFGDYSGTWGFIRWLDLGKRQQLDRSQWMMSFTAPDGHTLQWVLRSQLGSGPLALL
ALRGFTLPEQIFSVDSAATAQALMTKTEDSDMDGTE
 
Nucleotide Sequence: 3471 bp     [Download]
>gi|397655102|ref|NC_018106.1|:c3537267-3533797 Klebsiella oxytoca E718 chromosome, complete genome
ATGAGGCGCTTCCTCTCGCTATTTAAAAAACCGGAAATTGTGTTCTGGCTTTTGGTGTTAATTGTGCTGG
TTTGCAGCCTTGCCGTGGTGAGTATCGTCTACTGGCTGCCTGAAAGGCTACAGCTCATCAGGGAAACCTC
CGCCTGGTATGCCTGGTTGAGCGGTTCTGTGGCAGCAAGTATTGCACTGGCCATAACTGGAGTATTTCTT
TTCTTTGGTGCGCGAGCTGAAGGTAAACGTAGCTTCAGTAAAGAGCGGCAAAATGCGCAGGGTGATGATG
TTAAGACGCCACCAAAGAAAGATGTAACACCCGTATCTGCTGCAGTGACGACCCGTCAACAAATTCGCGA
TCACCTCCGCCGCCGTTACCATCTTTTCTGGTACCACAAAGTCCGCCTGCTGCTGATTACCGGCGATGAA
GCCGCAATCGAACAGCTGGTTCCCGGCCTGCAACAGCAGCAGTGGCTCGAAGGCAACCGCACCGTGCTGA
TTTACGGTGGCAGCCTGGCACCGGAGCCTGACCGTGAAAAATACACCGCATTACGCAAGCTGCGCCGCGG
ACGCCCGCTGGACGGGATTGTCCGCGTCATGCCGCAGTCACTTAACCTGGCCCCGCAAATCAGCGACAGC
GATTTACGCGGGCTGGAAAAAATCAGCGAACTGCTGCGTTATTCCGCCCCGGTCTGGCTGTGGCAGCTGT
GCGACAGCAACTGGTCGCAGGGTATGCGTCCTGAGCAGGCTGTGGGGGCAAGTTTTCCCCTACGCGCAAA
AGAAGACGATATTATCCGCCAGCTGGAGCGGATGCTCCCGGCCCTGCGGGCGCAGGGGGTAAGCCAGGTC
GCTGAGAACAACAGCCACGACTTCCTGCTGCGTCTGGGCCAGCACCTCCAGGACGGCGGTATCGTCCGCC
GGGCTCAGCAACTGCTGCCATGGCTCTACGACTCTCAGCAGCGTGTTCCTCTACGTGGCCTGATGTTCAG
CCTGCCGGAGAATAAATCCGCCAGTACGTCAGCGGGAACAGCCGATGCTGAGCAATATATCCCTGAATTA
CAGCGCCATGCCCTGACCCTGCCGGCGACCTGGCAGGGTATCGTTGACGACTGCACCCGTGTGCGGGGCC
GCCGTGTCGGCATGGCGTGGGAGAGGACGCTTGCCTGGACACTGATGACCATCATCGTTGTCTGGGGGGC
GGGAATGCTGCTGTCGTTTACGGTCAACCGCCAGCAGATAGTCTCCGTCGCCGAACAGGCACATGCCCTG
GTGGCGCATCCTTCCGTATCGGACAACCAGCTGACGGCCCTGCATACTCTGCGTAATGATGCCGGGCGTC
TGCAGCATAATGCTCAGGAGGGCGCCCCCTGGTATCAGCGCTTCGGCCTGGACCATAACCAGCAGTTGCT
CCGCGCGATGCTCCCCTGGTACGGCGTGGCCAACAACCGCCTGATACGCGACCCGGCAAATGAGGCGCTT
AAGCAAAAGCTCAGTGCGCTGGCAAACTCTGCACCCAACAGCGACCAGCGGGCGCAGCTGGCGAAACCGG
GCTACGACCAGCTGAAGGCCTGGCTGATGATGGCCCGGCCGGATAAAGCCGACGGCGCATTCTACGCACA
GACCATGAAAACCGTGCAGCCGACGCGGACAGGTATCTCAGCCGGTCTGTGGCAGAGCCTGGCGCCGGAT
TTGTGGGCTTTTTACATTTCCGAACTGCCTGCGCAGCCAAAGTGGGTAATCACGCCGGATGCGCAGCTGA
TCAGCCAGAGCCGCCAGGTCCTGCTGCAGCAGATAGGACGGCGCAACGCGGAAAGCACGCTGTATGAGAA
CATGCTCAAATCCGTGCGTCGTAACTTTGCCGATGTGTCTCTGGAGGACATGACTGGCGGTACCGATGCG
CGGCGACTGTTTACCACCGAGGAGGTGGTGCCGGGAATGTTTACCCGCCAGGCCTGGGATGGGGGGATTC
AGCAGGCCATCGAAAAGGCGGCGAATTCCCGCCGGGATGAAATCGACTGGGTGCTCAGCGACAGCCGAAA
AGCCGTCTCCTCAGACCTGTCGCCGGAAGCCCTGAAAGCGCGTCTGACACAGCGTTACTTCACTGACTTT
GCCGGCAGCTGGCTGAGCTTCCTCAACAGCCTGCAGCTTAATCCGGCGAACAATATTGCAGACGTTACCG
ATCAGCTGACGCTGATGAGTGACGTCCGCCAGTCGCCGCTGATTGCCCTGATGAATACGCTCGCCTGGCA
GGGACAGACCGGCCAGCAAAGCGAAGGCCTTTCGGATTCCATCATCAAATCGGCCAAAGACCTGGTCGGC
GGAAAAGACAAACCGGTGATTGACCAGTCTGCATCAGGCCCGCAGGGGCCGCTGGATGAAACCTTTGGTC
CGCTGCTTCAGCTGCTGGGCAAAAACAAAGGCAGCAACGTGATGTCGGCGGATAACACGCTGAGCCTGCA
GACTTACCTGACCCGTATCACCCGCGTGCGTCTGCGCCTGCAACAGGTAGCCAGCGCTTCTGACCCGCAG
GCGATGATGCAGACCCTGGCGCAGACCGTATTCCAGGGCAAAAGCGTGGACCTCACCGACACCTGGCAGT
ACGGCAGCCTGATTTCGGCAAGCCTTGGCGAGGAGTGGAGCGGATTTGGCAGCACAATGTTTGTGCAGCC
GCTGACTCAGGCCTGGGAGACCGTGCTTCAGCCGTCGGCAGCCAGCCTGAATGATAAATGGAGCCGCTCG
GTTGTCGCGAACTGGCAAACTGCCTTTGACGGTCGTTTCCCGTTTGCCGCCAGCAAAAGTGATGCCTCCC
TGCCGATGCTGGCGGAGTTTGTGCGCAAGGACAGCGGGCGCATTGAGCGCTTCCTGACGACGGAGCTCAG
CGGTGTGCTGCACAAGGAGGGCAGCCAGTGGGTGCCGGATAAGGTCAACAGCCAGGGGCTGAGCTTCAAC
CCGGCCTTCCTGCGGGCCATTAATCAGCTGAGCCAGCTGTCGGACATTCTGTTTACCGATGGCAATCAGG
GCATTACCTTTGAGCTGCAGGCGCGCCCTGTGCCGCAGGTGGTGGAAACGCAGCTGACCATTGATGGGCA
AAAGCTGCACTACTTTAACCAGATGGCTGACTGGCAGTCCATTCGCTGGCCTGGCGACACTTACAAGCCA
GGAACCATGCTGACCTGGACCACCGTCAATGCCGGTGCGCGTCTGTTTGGTGATTACAGCGGGACCTGGG
GCTTTATTCGCTGGCTTGACCTGGGTAAGCGCCAGCAGCTTGACCGCAGCCAGTGGATGATGAGTTTCAC
CGCACCGGATGGTCATACCCTGCAGTGGGTGCTGCGTTCACAGCTTGGCAGCGGGCCGCTGGCGTTACTG
GCACTGCGCGGCTTCACGCTGCCGGAACAGATATTCAGCGTCGACAGCGCGGCTACGGCTCAGGCGCTGA
TGACCAAAACGGAAGACAGTGATATGGACGGAACTGAATGA
 Primer design